| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY338028.1 | 5prime_partial | 168 | 1-507(+) |
Amino Acid sequence : | |||
| RIVTLYGNIMSDFASHAFGVLAEDGFSPATVYSSVNASYTVDYRAPVGNKTVEFSPAEVARVFKYLYQSSANPIFENMTWRQCGEAFASDIVRYFKELQPDAQSWLVKSNPVLAGNAPWV ALDVTDGLDIRHLNPEEKKVIARAKNHLLRSMQLKGRESLSAEALLES* | |||
Physicochemical properties | |||
| Number of amino acids: | 168 | ||
| Molecular weight: | 11,322.117 | ||
| Theoretical pI: | 9.300 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 19480 19855 | ||
| Instability index: | 46.219 | ||
| aromaticity | 0.101 | ||
| GRAVY | 0.051 | ||
Secondary Structure Fraction | |||
| Helix | 0.354 | ||
| turn | 0.303 | ||
| sheet | 0.141 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY338028.1 | complete | 99 | 396-97(-) |
Amino Acid sequence : | |||
| MPYIKAISNIQSNPWCIPSQNWIGFNQPTLCIWLELFEISNNITGKGFTTLPPCHILENGICRTLVQVLKNSCNFSRTKFHRLISYRGSVINSIACIHR* | |||
Physicochemical properties | |||
| Number of amino acids: | 99 | ||
| Molecular weight: | 11,322.117 | ||
| Theoretical pI: | 9.300 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 19480 19855 | ||
| Instability index: | 46.219 | ||
| aromaticity | 0.101 | ||
| GRAVY | 0.051 | ||
Secondary Structure Fraction | |||
| Helix | 0.354 | ||
| turn | 0.303 | ||
| sheet | 0.141 | ||