| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY338029.1 | 5prime_partial | 197 | 3-596(+) |
Amino Acid sequence : | |||
| YGYHMKAFTTFKIAHARLTAAAIVSNYPAAFDGLPSVVDVGGRHGTAIGRLVEAFPWVRGIAFDLPEIVADAPPRKGVDFVGGDMFESVPKADAVMLMWILHDWSDDKCIEILKKCKEAI PASTGKVMIVDAIINEDGEGDEFSGARLSLDMIMLAVMAQGKERTYKEWVHLLNEAGFSKHTVKNIKSIESVIEAYP* | |||
Physicochemical properties | |||
| Number of amino acids: | 197 | ||
| Molecular weight: | 18,561.937 | ||
| Theoretical pI: | 11.853 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 19940 19940 | ||
| Instability index: | 90.416 | ||
| aromaticity | 0.131 | ||
| GRAVY | -0.773 | ||
Secondary Structure Fraction | |||
| Helix | 0.307 | ||
| turn | 0.216 | ||
| sheet | 0.137 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY338029.1 | complete | 153 | 515-54(-) |
Amino Acid sequence : | |||
| MHPFLISSLLSLRHHRQHYHIQRQTSTRKLVAFSIFVNYSIYNHHFSGTRWNRFFAFLQNFYAFIVAPVMQYPHEHDRVGFRHAFKHVPSDEVDPFTRRSIRHNLRQIKRNSPHPRKRLH QSPDSRSVAAAHIHHRWQSVKRRRIVAYNGSRR* | |||
Physicochemical properties | |||
| Number of amino acids: | 153 | ||
| Molecular weight: | 18,561.937 | ||
| Theoretical pI: | 11.853 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 19940 19940 | ||
| Instability index: | 90.416 | ||
| aromaticity | 0.131 | ||
| GRAVY | -0.773 | ||
Secondary Structure Fraction | |||
| Helix | 0.307 | ||
| turn | 0.216 | ||
| sheet | 0.137 | ||