Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY338038.1 | internal | 233 | 3-701(+) |
Amino Acid sequence : | |||
FLSPFDRFMIKTLRKSEVKVLLRMLPNYHRHVRRYDNTLITKFFGLHRIKPSSGQKFRFVVMGNMFCTELRIHRRFDLKGSSLGRSADKVEIDENTILKDLDLNYCFYLEPSWRDSLLQQ IEIDSKLLESENIMDYSLLLGVHYRAPQHLRSLMSHSLRMSVDGLGIVAEDESMEDEPQGLVLVPRGADDSSLIVGSHIRGSRLRASSSTGDEEVDLLLPGTARLPIQLGVNM | |||
Physicochemical properties | |||
Number of amino acids: | 233 | ||
Molecular weight: | 26,692.462 | ||
Theoretical pI: | 7.260 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 14440 14565 | ||
Instability index: | 61.001 | ||
aromaticity | 0.073 | ||
GRAVY | -0.253 | ||
Secondary Structure Fraction | |||
Helix | 0.335 | ||
turn | 0.236 | ||
sheet | 0.270 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY338038.1 | internal | 233 | 3-701(+) |
Amino Acid sequence : | |||
FLSPFDRFMIKTLRKSEVKVLLRMLPNYHRHVRRYDNTLITKFFGLHRIKPSSGQKFRFVVMGNMFCTELRIHRRFDLKGSSLGRSADKVEIDENTILKDLDLNYCFYLEPSWRDSLLQQ IEIDSKLLESENIMDYSLLLGVHYRAPQHLRSLMSHSLRMSVDGLGIVAEDESMEDEPQGLVLVPRGADDSSLIVGSHIRGSRLRASSSTGDEEVDLLLPGTARLPIQLGVNM | |||
Physicochemical properties | |||
Number of amino acids: | 233 | ||
Molecular weight: | 26,692.462 | ||
Theoretical pI: | 7.260 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 14440 14565 | ||
Instability index: | 61.001 | ||
aromaticity | 0.073 | ||
GRAVY | -0.253 | ||
Secondary Structure Fraction | |||
Helix | 0.335 | ||
turn | 0.236 | ||
sheet | 0.270 |