| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY338051.1 | internal | 238 | 1-714(+) |
Amino Acid sequence : | |||
| ARRLGSCNEDFDNLGDVFIWGEGTGSGVMGGGLIRYDKSSNKNIDALMPKALESTMVLDVQTIACGQRHAVLVTKQGEIYSWGEEAGGRLGHGVDGDIFHPKLIETLNGKSIEMVACGDY HTCAVSLSGDLYTWGDGSFNCGLLGQGSNASHWIPKRVGGPIEGLQVSFVSCGPWHTALITSGVLFTFGDGTFGALGHGDHSSTSIPRVVEALKEFQAERVACGVWHTAAVVKINSGS | |||
Physicochemical properties | |||
| Number of amino acids: | 238 | ||
| Molecular weight: | 12,064.275 | ||
| Theoretical pI: | 9.548 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 8480 8730 | ||
| Instability index: | 100.675 | ||
| aromaticity | 0.054 | ||
| GRAVY | 0.074 | ||
Secondary Structure Fraction | |||
| Helix | 0.270 | ||
| turn | 0.351 | ||
| sheet | 0.234 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY338051.1 | 3prime_partial | 111 | 335-3(-) |
Amino Acid sequence : | |||
| MLFPLRVSMSFGWKMSPSTPCPSLPPASSPQLYISPCLVTKTACLCPQAMVCTSSTIVDSNALGIRASMFLLDDLSYLIRPPPITPLPVPSPQMKTSPKLSKSSLQEPKRR | |||
Physicochemical properties | |||
| Number of amino acids: | 111 | ||
| Molecular weight: | 12,064.275 | ||
| Theoretical pI: | 9.548 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 8480 8730 | ||
| Instability index: | 100.675 | ||
| aromaticity | 0.054 | ||
| GRAVY | 0.074 | ||
Secondary Structure Fraction | |||
| Helix | 0.270 | ||
| turn | 0.351 | ||
| sheet | 0.234 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY338051.1 | internal | 238 | 1-714(+) |
Amino Acid sequence : | |||
| ARRLGSCNEDFDNLGDVFIWGEGTGSGVMGGGLIRYDKSSNKNIDALMPKALESTMVLDVQTIACGQRHAVLVTKQGEIYSWGEEAGGRLGHGVDGDIFHPKLIETLNGKSIEMVACGDY HTCAVSLSGDLYTWGDGSFNCGLLGQGSNASHWIPKRVGGPIEGLQVSFVSCGPWHTALITSGVLFTFGDGTFGALGHGDHSSTSIPRVVEALKEFQAERVACGVWHTAAVVKINSGS | |||
Physicochemical properties | |||
| Number of amino acids: | 238 | ||
| Molecular weight: | 12,064.275 | ||
| Theoretical pI: | 9.548 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 8480 8730 | ||
| Instability index: | 100.675 | ||
| aromaticity | 0.054 | ||
| GRAVY | 0.074 | ||
Secondary Structure Fraction | |||
| Helix | 0.270 | ||
| turn | 0.351 | ||
| sheet | 0.234 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY338051.1 | 3prime_partial | 111 | 335-3(-) |
Amino Acid sequence : | |||
| MLFPLRVSMSFGWKMSPSTPCPSLPPASSPQLYISPCLVTKTACLCPQAMVCTSSTIVDSNALGIRASMFLLDDLSYLIRPPPITPLPVPSPQMKTSPKLSKSSLQEPKRR | |||
Physicochemical properties | |||
| Number of amino acids: | 111 | ||
| Molecular weight: | 12,064.275 | ||
| Theoretical pI: | 9.548 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 8480 8730 | ||
| Instability index: | 100.675 | ||
| aromaticity | 0.054 | ||
| GRAVY | 0.074 | ||
Secondary Structure Fraction | |||
| Helix | 0.270 | ||
| turn | 0.351 | ||
| sheet | 0.234 | ||