| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY338054.1 | 3prime_partial | 254 | 27-788(+) |
Amino Acid sequence : | |||
| MANNTNAGVITCKAAVAWKPSEPLVVEEICVEPPKSTEVRIKMLAASMCHTDILLWKGFFPLYPRIPGHEGAGVIESVGEKVTNLKVGDTVMPLSIGQCGECSNCATGKTNICFKYPFGI SGLMPDGTSRMSAKGQKLYHMFTCSTWSEYTVVDSNFVVKVDPRIPLPHASLLTCGFLTGYGAPWRESRVEKGSTVAVIGLGAVGLGAVSASRILGASKIIGIDVNELKREKATVFRVTE FINPKHSDKTVSQL | |||
Physicochemical properties | |||
| Number of amino acids: | 254 | ||
| Molecular weight: | 12,796.757 | ||
| Theoretical pI: | 7.891 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 8480 8605 | ||
| Instability index: | 43.955 | ||
| aromaticity | 0.092 | ||
| GRAVY | 0.465 | ||
Secondary Structure Fraction | |||
| Helix | 0.325 | ||
| turn | 0.283 | ||
| sheet | 0.217 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY338054.1 | 3prime_partial | 120 | 361-2(-) |
Amino Acid sequence : | |||
| MFVFPVAQLEHSPHCPMESGITVSPTLRFVTFSPTLSITPAPSCPGIRGYRGKKPFQSRISVWHMLAASILILTSVDLGGSTQISSTTSGSDGFHATAALHVMTPAFVLFAMVDILYTGV | |||
Physicochemical properties | |||
| Number of amino acids: | 120 | ||
| Molecular weight: | 12,796.757 | ||
| Theoretical pI: | 7.891 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 8480 8605 | ||
| Instability index: | 43.955 | ||
| aromaticity | 0.092 | ||
| GRAVY | 0.465 | ||
Secondary Structure Fraction | |||
| Helix | 0.325 | ||
| turn | 0.283 | ||
| sheet | 0.217 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY338054.1 | 3prime_partial | 254 | 27-788(+) |
Amino Acid sequence : | |||
| MANNTNAGVITCKAAVAWKPSEPLVVEEICVEPPKSTEVRIKMLAASMCHTDILLWKGFFPLYPRIPGHEGAGVIESVGEKVTNLKVGDTVMPLSIGQCGECSNCATGKTNICFKYPFGI SGLMPDGTSRMSAKGQKLYHMFTCSTWSEYTVVDSNFVVKVDPRIPLPHASLLTCGFLTGYGAPWRESRVEKGSTVAVIGLGAVGLGAVSASRILGASKIIGIDVNELKREKATVFRVTE FINPKHSDKTVSQL | |||
Physicochemical properties | |||
| Number of amino acids: | 254 | ||
| Molecular weight: | 12,796.757 | ||
| Theoretical pI: | 7.891 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 8480 8605 | ||
| Instability index: | 43.955 | ||
| aromaticity | 0.092 | ||
| GRAVY | 0.465 | ||
Secondary Structure Fraction | |||
| Helix | 0.325 | ||
| turn | 0.283 | ||
| sheet | 0.217 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY338054.1 | 3prime_partial | 120 | 361-2(-) |
Amino Acid sequence : | |||
| MFVFPVAQLEHSPHCPMESGITVSPTLRFVTFSPTLSITPAPSCPGIRGYRGKKPFQSRISVWHMLAASILILTSVDLGGSTQISSTTSGSDGFHATAALHVMTPAFVLFAMVDILYTGV | |||
Physicochemical properties | |||
| Number of amino acids: | 120 | ||
| Molecular weight: | 12,796.757 | ||
| Theoretical pI: | 7.891 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 8480 8605 | ||
| Instability index: | 43.955 | ||
| aromaticity | 0.092 | ||
| GRAVY | 0.465 | ||
Secondary Structure Fraction | |||
| Helix | 0.325 | ||
| turn | 0.283 | ||
| sheet | 0.217 | ||