| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY338058.1 | 5prime_partial | 129 | 3-392(+) |
Amino Acid sequence : | |||
| NGDDSPFMRRVLPRALSNGIPGRAFSAEAAQSTPPAPIITKSPDRVKWDYRGQRKIIPLGQWAPKVAVDAYVAPNVVLAGQVVVYDGASGWNGADLRGDLNKISVGFCSSVQERCVVHAA WSSPTGLPA* | |||
Physicochemical properties | |||
| Number of amino acids: | 129 | ||
| Molecular weight: | 13,712.425 | ||
| Theoretical pI: | 9.388 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 26470 26595 | ||
| Instability index: | 35.337 | ||
| aromaticity | 0.078 | ||
| GRAVY | -0.148 | ||
Secondary Structure Fraction | |||
| Helix | 0.287 | ||
| turn | 0.310 | ||
| sheet | 0.202 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY338058.1 | 5prime_partial | 129 | 3-392(+) |
Amino Acid sequence : | |||
| NGDDSPFMRRVLPRALSNGIPGRAFSAEAAQSTPPAPIITKSPDRVKWDYRGQRKIIPLGQWAPKVAVDAYVAPNVVLAGQVVVYDGASGWNGADLRGDLNKISVGFCSSVQERCVVHAA WSSPTGLPA* | |||
Physicochemical properties | |||
| Number of amino acids: | 129 | ||
| Molecular weight: | 13,712.425 | ||
| Theoretical pI: | 9.388 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 26470 26595 | ||
| Instability index: | 35.337 | ||
| aromaticity | 0.078 | ||
| GRAVY | -0.148 | ||
Secondary Structure Fraction | |||
| Helix | 0.287 | ||
| turn | 0.310 | ||
| sheet | 0.202 | ||