| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY338065.1 | 5prime_partial | 226 | 745-65(-) |
Amino Acid sequence : | |||
| TTANPHDXVPFLEVNLYADNQIPDFSTYTSPRLFATHLPHISLPESIKQKPNCKIVYLCRNPKDIFVSLWHFFGIYKQPGEENNLIKEVSEMFCRGQNLYGPCWDHMMGYWKQHVENPDR VLFLKYEELRETPGVVLRRLSEFLGCPFSAAEEEAGLPEEILRLCSFGSLRGMEVNQKGKQSFGPENKSFFRRGVVGDWKNYLDEEMACKFDQIADEKFGGSGLKV* | |||
Physicochemical properties | |||
| Number of amino acids: | 226 | ||
| Molecular weight: | 25,938.280 | ||
| Theoretical pI: | 5.733 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 33920 34295 | ||
| Instability index: | 47.200 | ||
| aromaticity | 0.124 | ||
| GRAVY | -0.462 | ||
Secondary Structure Fraction | |||
| Helix | 0.316 | ||
| turn | 0.253 | ||
| sheet | 0.244 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY338065.1 | 5prime_partial | 226 | 745-65(-) |
Amino Acid sequence : | |||
| TTANPHDXVPFLEVNLYADNQIPDFSTYTSPRLFATHLPHISLPESIKQKPNCKIVYLCRNPKDIFVSLWHFFGIYKQPGEENNLIKEVSEMFCRGQNLYGPCWDHMMGYWKQHVENPDR VLFLKYEELRETPGVVLRRLSEFLGCPFSAAEEEAGLPEEILRLCSFGSLRGMEVNQKGKQSFGPENKSFFRRGVVGDWKNYLDEEMACKFDQIADEKFGGSGLKV* | |||
Physicochemical properties | |||
| Number of amino acids: | 226 | ||
| Molecular weight: | 25,938.280 | ||
| Theoretical pI: | 5.733 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 33920 34295 | ||
| Instability index: | 47.200 | ||
| aromaticity | 0.124 | ||
| GRAVY | -0.462 | ||
Secondary Structure Fraction | |||
| Helix | 0.316 | ||
| turn | 0.253 | ||
| sheet | 0.244 | ||