| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY338074.1 | complete | 220 | 126-788(+) |
Amino Acid sequence : | |||
| MASSISAGLSFNPIPHSLTQKTTPSLFSHPSTQLRVAHEVPPATLSNPTAANDALLASPPRALEKDPRQLWNRYVDWLYQHKELGLYLDVSRVGFTDDFLRDMEPRIQKAFDDMVGLEKG AISNPDEGRMVGHYWLRNPKLAPKAILTQQIESTLERICQFADQVISGKIRPPGKDKFTQILSIGIGGSALGPQFVAEALAPDNPPLKIRFIDNYKSTWD* | |||
Physicochemical properties | |||
| Number of amino acids: | 220 | ||
| Molecular weight: | 12,060.858 | ||
| Theoretical pI: | 12.000 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 38500 38625 | ||
| Instability index: | 59.068 | ||
| aromaticity | 0.101 | ||
| GRAVY | -0.440 | ||
Secondary Structure Fraction | |||
| Helix | 0.220 | ||
| turn | 0.385 | ||
| sheet | 0.174 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY338074.1 | complete | 137 | 524-111(-) |
Amino Acid sequence : | |||
| MPHHSPLIGIRNRPLLQPDHVIKSLLNSGLHVAEEIVGEADPANIQVEAQLLVLVKPINVPVPQLAGVFFKSAWGRREQGVVGGGGIGECGGGNLMRDPQLGGGMREERGGGLLREGVGD GVEGEAGRDGGSHGRLE* | |||
Physicochemical properties | |||
| Number of amino acids: | 137 | ||
| Molecular weight: | 12,060.858 | ||
| Theoretical pI: | 12.000 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 38500 38625 | ||
| Instability index: | 59.068 | ||
| aromaticity | 0.101 | ||
| GRAVY | -0.440 | ||
Secondary Structure Fraction | |||
| Helix | 0.220 | ||
| turn | 0.385 | ||
| sheet | 0.174 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY338074.1 | complete | 109 | 238-567(+) |
Amino Acid sequence : | |||
| MRFPPPHSPIPPPPTTPCSRRPHALLKKTPASCGTGTLIGFTSTRSWASTWMLAGSASPTISSATWSPEFRRLLMTWSGWRRGRFRIPMRGEWWGITGSGIRSSPPKLS* | |||
Physicochemical properties | |||
| Number of amino acids: | 109 | ||
| Molecular weight: | 12,060.858 | ||
| Theoretical pI: | 12.000 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 38500 38625 | ||
| Instability index: | 59.068 | ||
| aromaticity | 0.101 | ||
| GRAVY | -0.440 | ||
Secondary Structure Fraction | |||
| Helix | 0.220 | ||
| turn | 0.385 | ||
| sheet | 0.174 | ||