Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY338074.1 | complete | 220 | 126-788(+) |
Amino Acid sequence : | |||
MASSISAGLSFNPIPHSLTQKTTPSLFSHPSTQLRVAHEVPPATLSNPTAANDALLASPPRALEKDPRQLWNRYVDWLYQHKELGLYLDVSRVGFTDDFLRDMEPRIQKAFDDMVGLEKG AISNPDEGRMVGHYWLRNPKLAPKAILTQQIESTLERICQFADQVISGKIRPPGKDKFTQILSIGIGGSALGPQFVAEALAPDNPPLKIRFIDNYKSTWD* | |||
Physicochemical properties | |||
Number of amino acids: | 220 | ||
Molecular weight: | 12,060.858 | ||
Theoretical pI: | 12.000 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 38500 38625 | ||
Instability index: | 59.068 | ||
aromaticity | 0.101 | ||
GRAVY | -0.440 | ||
Secondary Structure Fraction | |||
Helix | 0.220 | ||
turn | 0.385 | ||
sheet | 0.174 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY338074.1 | complete | 137 | 524-111(-) |
Amino Acid sequence : | |||
MPHHSPLIGIRNRPLLQPDHVIKSLLNSGLHVAEEIVGEADPANIQVEAQLLVLVKPINVPVPQLAGVFFKSAWGRREQGVVGGGGIGECGGGNLMRDPQLGGGMREERGGGLLREGVGD GVEGEAGRDGGSHGRLE* | |||
Physicochemical properties | |||
Number of amino acids: | 137 | ||
Molecular weight: | 12,060.858 | ||
Theoretical pI: | 12.000 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 38500 38625 | ||
Instability index: | 59.068 | ||
aromaticity | 0.101 | ||
GRAVY | -0.440 | ||
Secondary Structure Fraction | |||
Helix | 0.220 | ||
turn | 0.385 | ||
sheet | 0.174 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY338074.1 | complete | 109 | 238-567(+) |
Amino Acid sequence : | |||
MRFPPPHSPIPPPPTTPCSRRPHALLKKTPASCGTGTLIGFTSTRSWASTWMLAGSASPTISSATWSPEFRRLLMTWSGWRRGRFRIPMRGEWWGITGSGIRSSPPKLS* | |||
Physicochemical properties | |||
Number of amino acids: | 109 | ||
Molecular weight: | 12,060.858 | ||
Theoretical pI: | 12.000 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 38500 38625 | ||
Instability index: | 59.068 | ||
aromaticity | 0.101 | ||
GRAVY | -0.440 | ||
Secondary Structure Fraction | |||
Helix | 0.220 | ||
turn | 0.385 | ||
sheet | 0.174 |