Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY338096.1 | internal | 251 | 2-754(+) |
Amino Acid sequence : | |||
HDRLVPNSARGDKEVQLHAQAWEHALSYINSTALSAAVELEIPDILEDHGGLMSLSELSAASGCPREPLYRLMRFLIFHGIFTKSDDCYAQSPLSRLFTRENLGPYMLMQATPVTRSPAG LSGEALKTGTSLYLKSIRGEDSWSDPAYGYHMKAFTNAMIAHARLTAAAIVSNYPAAFDGLRSVVDVGGRHGTAIGRLVEAFPWVRGIAFDLPEIVADAPPRKGVDFVGGDMFESVPKAD AVMLMWILHDW | |||
Physicochemical properties | |||
Number of amino acids: | 251 | ||
Molecular weight: | 14,106.923 | ||
Theoretical pI: | 11.558 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 1490 1490 | ||
Instability index: | 71.436 | ||
aromaticity | 0.040 | ||
GRAVY | -0.681 | ||
Secondary Structure Fraction | |||
Helix | 0.248 | ||
turn | 0.176 | ||
sheet | 0.264 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY338096.1 | 5prime_partial | 139 | 1-420(+) |
Amino Acid sequence : | |||
ARPLSAEFGTRRQRSSTSCTSMGARPKLHQLHGAVCGGGAGDSRHPGRSRRPDVAVGALRRLRLPPRAALPPHEIPHLPRHLHQIRRLLRPVAAFSAFHERESGTLHVDAGDAGNEVSCG LERRSLENGDKPLSQVDQR* | |||
Physicochemical properties | |||
Number of amino acids: | 139 | ||
Molecular weight: | 14,106.923 | ||
Theoretical pI: | 11.558 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 1490 1490 | ||
Instability index: | 71.436 | ||
aromaticity | 0.040 | ||
GRAVY | -0.681 | ||
Secondary Structure Fraction | |||
Helix | 0.248 | ||
turn | 0.176 | ||
sheet | 0.264 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY338096.1 | complete | 125 | 454-77(-) |
Amino Acid sequence : | |||
MVAVGRVAPRILTSDRLEIKACPRFQGFAAQARRRPRYRRRLHQHVGSQILSREKPRKRRLGVAVVGFGEDAVEDEESHEAVERLAGAAGGGGELRQRHQAAVIFQDVGNLQLHRRRQRR GVDVT* | |||
Physicochemical properties | |||
Number of amino acids: | 125 | ||
Molecular weight: | 14,106.923 | ||
Theoretical pI: | 11.558 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 1490 1490 | ||
Instability index: | 71.436 | ||
aromaticity | 0.040 | ||
GRAVY | -0.681 | ||
Secondary Structure Fraction | |||
Helix | 0.248 | ||
turn | 0.176 | ||
sheet | 0.264 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY338096.1 | internal | 251 | 2-754(+) |
Amino Acid sequence : | |||
HDRLVPNSARGDKEVQLHAQAWEHALSYINSTALSAAVELEIPDILEDHGGLMSLSELSAASGCPREPLYRLMRFLIFHGIFTKSDDCYAQSPLSRLFTRENLGPYMLMQATPVTRSPAG LSGEALKTGTSLYLKSIRGEDSWSDPAYGYHMKAFTNAMIAHARLTAAAIVSNYPAAFDGLRSVVDVGGRHGTAIGRLVEAFPWVRGIAFDLPEIVADAPPRKGVDFVGGDMFESVPKAD AVMLMWILHDW | |||
Physicochemical properties | |||
Number of amino acids: | 251 | ||
Molecular weight: | 14,106.923 | ||
Theoretical pI: | 11.558 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 1490 1490 | ||
Instability index: | 71.436 | ||
aromaticity | 0.040 | ||
GRAVY | -0.681 | ||
Secondary Structure Fraction | |||
Helix | 0.248 | ||
turn | 0.176 | ||
sheet | 0.264 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY338096.1 | 5prime_partial | 139 | 1-420(+) |
Amino Acid sequence : | |||
ARPLSAEFGTRRQRSSTSCTSMGARPKLHQLHGAVCGGGAGDSRHPGRSRRPDVAVGALRRLRLPPRAALPPHEIPHLPRHLHQIRRLLRPVAAFSAFHERESGTLHVDAGDAGNEVSCG LERRSLENGDKPLSQVDQR* | |||
Physicochemical properties | |||
Number of amino acids: | 139 | ||
Molecular weight: | 14,106.923 | ||
Theoretical pI: | 11.558 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 1490 1490 | ||
Instability index: | 71.436 | ||
aromaticity | 0.040 | ||
GRAVY | -0.681 | ||
Secondary Structure Fraction | |||
Helix | 0.248 | ||
turn | 0.176 | ||
sheet | 0.264 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY338096.1 | complete | 125 | 454-77(-) |
Amino Acid sequence : | |||
MVAVGRVAPRILTSDRLEIKACPRFQGFAAQARRRPRYRRRLHQHVGSQILSREKPRKRRLGVAVVGFGEDAVEDEESHEAVERLAGAAGGGGELRQRHQAAVIFQDVGNLQLHRRRQRR GVDVT* | |||
Physicochemical properties | |||
Number of amino acids: | 125 | ||
Molecular weight: | 14,106.923 | ||
Theoretical pI: | 11.558 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 1490 1490 | ||
Instability index: | 71.436 | ||
aromaticity | 0.040 | ||
GRAVY | -0.681 | ||
Secondary Structure Fraction | |||
Helix | 0.248 | ||
turn | 0.176 | ||
sheet | 0.264 |