Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY338109.1 | 5prime_partial | 204 | 1-615(+) |
Amino Acid sequence : | |||
RWSLPLPSLKFTATPSSSSVPVVVAAATSMVGAETQAGAATPAKVLPFRVGHGFDLHRLEPGYPLIIGGINIPHDRGCEAHSDGDVLLHCVVDAILGALGLPDIGQIFPDTDPKWKGAPS SVFMEEAVRLMHEAGYELGNLDATLILQRPKVSPHKEAIRANLCKLLGAHPSVVNLKAKTHEKVDSLGENRSIAAHTVVLLFTK* | |||
Physicochemical properties | |||
Number of amino acids: | 204 | ||
Molecular weight: | 21,679.796 | ||
Theoretical pI: | 6.861 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 13980 14105 | ||
Instability index: | 34.801 | ||
aromaticity | 0.049 | ||
GRAVY | 0.086 | ||
Secondary Structure Fraction | |||
Helix | 0.304 | ||
turn | 0.255 | ||
sheet | 0.289 |