| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY338109.1 | 5prime_partial | 204 | 1-615(+) |
Amino Acid sequence : | |||
| RWSLPLPSLKFTATPSSSSVPVVVAAATSMVGAETQAGAATPAKVLPFRVGHGFDLHRLEPGYPLIIGGINIPHDRGCEAHSDGDVLLHCVVDAILGALGLPDIGQIFPDTDPKWKGAPS SVFMEEAVRLMHEAGYELGNLDATLILQRPKVSPHKEAIRANLCKLLGAHPSVVNLKAKTHEKVDSLGENRSIAAHTVVLLFTK* | |||
Physicochemical properties | |||
| Number of amino acids: | 204 | ||
| Molecular weight: | 21,679.796 | ||
| Theoretical pI: | 6.861 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 13980 14105 | ||
| Instability index: | 34.801 | ||
| aromaticity | 0.049 | ||
| GRAVY | 0.086 | ||
Secondary Structure Fraction | |||
| Helix | 0.304 | ||
| turn | 0.255 | ||
| sheet | 0.289 | ||