| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY338112.1 | complete | 173 | 166-687(+) |
Amino Acid sequence : | |||
| MLNYYSSNSSKPTQCDSQGDNGRLAQSLASPSTPEKPNASGSTPPCPYGTPPQPQPSTRRPPQKKHRRPPSSQSWGSKTQHTHTPAGGTQPPACHSASSTLPRYGTLSSPNISASVDTAS TLFPIFDVAKSTMDSRKVAQTFSSPFMPFSSHSWMVFFMASASTESGSTENLV* | |||
Physicochemical properties | |||
| Number of amino acids: | 173 | ||
| Molecular weight: | 11,303.459 | ||
| Theoretical pI: | 4.418 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 2980 3105 | ||
| Instability index: | 39.562 | ||
| aromaticity | 0.078 | ||
| GRAVY | -0.537 | ||
Secondary Structure Fraction | |||
| Helix | 0.245 | ||
| turn | 0.225 | ||
| sheet | 0.294 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY338112.1 | complete | 117 | 227-580(+) |
Amino Acid sequence : | |||
| MADWHSPWLHLQHLKSQMLRVPLRRVPMAHRHSLSLRPAGPHKKNIVGHRRLSLGAVKHSILILLLGAHNHRLVTRLPRHSLDTVHFPLRTYPLLSTLLRRCSLFLMWRNQPWTPEK* | |||
Physicochemical properties | |||
| Number of amino acids: | 117 | ||
| Molecular weight: | 11,303.459 | ||
| Theoretical pI: | 4.418 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 2980 3105 | ||
| Instability index: | 39.562 | ||
| aromaticity | 0.078 | ||
| GRAVY | -0.537 | ||
Secondary Structure Fraction | |||
| Helix | 0.245 | ||
| turn | 0.225 | ||
| sheet | 0.294 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY338112.1 | 5prime_partial | 102 | 755-447(-) |
Amino Acid sequence : | |||
| QQKFLPRQVGDSIPFSSDKLPEIYTKFSVEPDSVEAEAMKKTIQECEEKGIKGEEKVCATFLESMVDFATSKIGNNVEAVSTEADMFGEESVPYRGSVEEAE* | |||
Physicochemical properties | |||
| Number of amino acids: | 102 | ||
| Molecular weight: | 11,303.459 | ||
| Theoretical pI: | 4.418 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 2980 3105 | ||
| Instability index: | 39.562 | ||
| aromaticity | 0.078 | ||
| GRAVY | -0.537 | ||
Secondary Structure Fraction | |||
| Helix | 0.245 | ||
| turn | 0.225 | ||
| sheet | 0.294 | ||