| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY338120.1 | complete | 189 | 2-571(+) |
Amino Acid sequence : | |||
| MATGLVRRAIARAPALSPAERVLIYRQHASEASAQQSKSSSSPKTFQIYRWNPDSPQKPELQNYEIDLKECGPMILNALIKIKNEIDPTLTFRRSCREGICGSCAMNIDSRNGLACLTKI PSSGATMITPLPHMFVIKDLVVDMTNFYNQYKSIEPWLKRKSPPENPGKEILQSTEDRKKLDGMYESIL* | |||
Physicochemical properties | |||
| Number of amino acids: | 189 | ||
| Molecular weight: | 13,045.916 | ||
| Theoretical pI: | 10.687 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 6990 7115 | ||
| Instability index: | 57.985 | ||
| aromaticity | 0.034 | ||
| GRAVY | -0.192 | ||
Secondary Structure Fraction | |||
| Helix | 0.303 | ||
| turn | 0.261 | ||
| sheet | 0.244 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY338120.1 | 5prime_partial | 119 | 628-269(-) |
Amino Acid sequence : | |||
| PQVRFRIPPVGGAGCDTAGSQNALVHPIELLPILRALQNLLPRVLRRALPLQPWLNRLILVVKVGHIDHQILNHKHVRQRSNHRRPTGRYFCETSETIPAVDVHGAGTADPLSAGASEG* | |||
Physicochemical properties | |||
| Number of amino acids: | 119 | ||
| Molecular weight: | 13,045.916 | ||
| Theoretical pI: | 10.687 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 6990 7115 | ||
| Instability index: | 57.985 | ||
| aromaticity | 0.034 | ||
| GRAVY | -0.192 | ||
Secondary Structure Fraction | |||
| Helix | 0.303 | ||
| turn | 0.261 | ||
| sheet | 0.244 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY338120.1 | complete | 189 | 2-571(+) |
Amino Acid sequence : | |||
| MATGLVRRAIARAPALSPAERVLIYRQHASEASAQQSKSSSSPKTFQIYRWNPDSPQKPELQNYEIDLKECGPMILNALIKIKNEIDPTLTFRRSCREGICGSCAMNIDSRNGLACLTKI PSSGATMITPLPHMFVIKDLVVDMTNFYNQYKSIEPWLKRKSPPENPGKEILQSTEDRKKLDGMYESIL* | |||
Physicochemical properties | |||
| Number of amino acids: | 189 | ||
| Molecular weight: | 13,045.916 | ||
| Theoretical pI: | 10.687 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 6990 7115 | ||
| Instability index: | 57.985 | ||
| aromaticity | 0.034 | ||
| GRAVY | -0.192 | ||
Secondary Structure Fraction | |||
| Helix | 0.303 | ||
| turn | 0.261 | ||
| sheet | 0.244 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY338120.1 | 5prime_partial | 119 | 628-269(-) |
Amino Acid sequence : | |||
| PQVRFRIPPVGGAGCDTAGSQNALVHPIELLPILRALQNLLPRVLRRALPLQPWLNRLILVVKVGHIDHQILNHKHVRQRSNHRRPTGRYFCETSETIPAVDVHGAGTADPLSAGASEG* | |||
Physicochemical properties | |||
| Number of amino acids: | 119 | ||
| Molecular weight: | 13,045.916 | ||
| Theoretical pI: | 10.687 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 6990 7115 | ||
| Instability index: | 57.985 | ||
| aromaticity | 0.034 | ||
| GRAVY | -0.192 | ||
Secondary Structure Fraction | |||
| Helix | 0.303 | ||
| turn | 0.261 | ||
| sheet | 0.244 | ||