| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY338121.1 | 3prime_partial | 210 | 34-663(+) |
Amino Acid sequence : | |||
| MDVENNVDANDIGHLSETANRPTKIRFEYDEDEEAETLEEAATESSNVDEDSTMCEQDNSDARDDKTSADYYFDSYSHFGIHEEMLKDVVRTKTYQNVIYKNSFLFKDKVVLDVGAGTGI LSLFCAKVGAKHVYAVECSSMANMAQEIVKQNGYSNAITVLKGKIEEIELPVTQVDVIISEWMGYFLVYENMLNTVLYARDKWLVKDGLV | |||
Physicochemical properties | |||
| Number of amino acids: | 210 | ||
| Molecular weight: | 23,763.222 | ||
| Theoretical pI: | 4.399 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 27390 27515 | ||
| Instability index: | 32.062 | ||
| aromaticity | 0.095 | ||
| GRAVY | -0.369 | ||
Secondary Structure Fraction | |||
| Helix | 0.314 | ||
| turn | 0.186 | ||
| sheet | 0.271 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY338121.1 | 3prime_partial | 210 | 34-663(+) |
Amino Acid sequence : | |||
| MDVENNVDANDIGHLSETANRPTKIRFEYDEDEEAETLEEAATESSNVDEDSTMCEQDNSDARDDKTSADYYFDSYSHFGIHEEMLKDVVRTKTYQNVIYKNSFLFKDKVVLDVGAGTGI LSLFCAKVGAKHVYAVECSSMANMAQEIVKQNGYSNAITVLKGKIEEIELPVTQVDVIISEWMGYFLVYENMLNTVLYARDKWLVKDGLV | |||
Physicochemical properties | |||
| Number of amino acids: | 210 | ||
| Molecular weight: | 23,763.222 | ||
| Theoretical pI: | 4.399 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 27390 27515 | ||
| Instability index: | 32.062 | ||
| aromaticity | 0.095 | ||
| GRAVY | -0.369 | ||
Secondary Structure Fraction | |||
| Helix | 0.314 | ||
| turn | 0.186 | ||
| sheet | 0.271 | ||