| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY338131.1 | 5prime_partial | 113 | 346-5(-) |
Amino Acid sequence : | |||
| NKMESKFAHIIVFFLLATSFESLMARKEIDGPEIIELLKEVESDLMCKGKQRWPALIGVPAQYAKGIIEKENSFITDVQIILNGSPVTTDFRCDRVRLFYNILGYVVQMPVVT* | |||
Physicochemical properties | |||
| Number of amino acids: | 113 | ||
| Molecular weight: | 12,867.979 | ||
| Theoretical pI: | 5.836 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 9970 10095 | ||
| Instability index: | 64.307 | ||
| aromaticity | 0.097 | ||
| GRAVY | 0.173 | ||
Secondary Structure Fraction | |||
| Helix | 0.381 | ||
| turn | 0.186 | ||
| sheet | 0.257 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY338131.1 | 5prime_partial | 113 | 346-5(-) |
Amino Acid sequence : | |||
| NKMESKFAHIIVFFLLATSFESLMARKEIDGPEIIELLKEVESDLMCKGKQRWPALIGVPAQYAKGIIEKENSFITDVQIILNGSPVTTDFRCDRVRLFYNILGYVVQMPVVT* | |||
Physicochemical properties | |||
| Number of amino acids: | 113 | ||
| Molecular weight: | 12,867.979 | ||
| Theoretical pI: | 5.836 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 9970 10095 | ||
| Instability index: | 64.307 | ||
| aromaticity | 0.097 | ||
| GRAVY | 0.173 | ||
Secondary Structure Fraction | |||
| Helix | 0.381 | ||
| turn | 0.186 | ||
| sheet | 0.257 | ||