| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY338142.1 | 3prime_partial | 222 | 12-677(+) |
Amino Acid sequence : | |||
| MAKSGILVIVSPLDVLAVCGVFAEENEYVLTLDHSNLTETVAKHNFVVVEFYAPWCGHCKSLAPEYEKAASKLTNHDPPIVLPKYDANDEANPELSKQYEIQGFPTIKILRDGGKKVQDY NGPREAAGIVSYLKKQVGPASAEIKSKEDATNLIDEKSIFVVGIFPYPSGEKFENYLTLAEKLRGEVDFAHTVDAKHLPQGGPLNKPTLRLLKPFDELFVDF | |||
Physicochemical properties | |||
| Number of amino acids: | 222 | ||
| Molecular weight: | 24,591.758 | ||
| Theoretical pI: | 5.300 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 18910 19035 | ||
| Instability index: | 27.491 | ||
| aromaticity | 0.095 | ||
| GRAVY | -0.239 | ||
Secondary Structure Fraction | |||
| Helix | 0.329 | ||
| turn | 0.230 | ||
| sheet | 0.270 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY338142.1 | 3prime_partial | 222 | 12-677(+) |
Amino Acid sequence : | |||
| MAKSGILVIVSPLDVLAVCGVFAEENEYVLTLDHSNLTETVAKHNFVVVEFYAPWCGHCKSLAPEYEKAASKLTNHDPPIVLPKYDANDEANPELSKQYEIQGFPTIKILRDGGKKVQDY NGPREAAGIVSYLKKQVGPASAEIKSKEDATNLIDEKSIFVVGIFPYPSGEKFENYLTLAEKLRGEVDFAHTVDAKHLPQGGPLNKPTLRLLKPFDELFVDF | |||
Physicochemical properties | |||
| Number of amino acids: | 222 | ||
| Molecular weight: | 24,591.758 | ||
| Theoretical pI: | 5.300 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 18910 19035 | ||
| Instability index: | 27.491 | ||
| aromaticity | 0.095 | ||
| GRAVY | -0.239 | ||
Secondary Structure Fraction | |||
| Helix | 0.329 | ||
| turn | 0.230 | ||
| sheet | 0.270 | ||