| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY338146.1 | 3prime_partial | 197 | 85-675(+) |
Amino Acid sequence : | |||
| MVPFPLQGHLNQLLHLCRLIAARDVPVHYVGTATHNRQARRRIQGWDPISTSNIKFHEFQPLSFISNPPDPDASIKFPSHLQPLFDTLHLLRRPISGLLEDLSSRARRVIVIYDSLMGSV VQDFVRFPNAESYIFHSVSAYTIFFFLWETNGRPFAIEPEILASLPSLEGCFTPEFLKFVVKQHKYLKLNSGRIYNT | |||
Physicochemical properties | |||
| Number of amino acids: | 197 | ||
| Molecular weight: | 11,707.567 | ||
| Theoretical pI: | 9.417 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 24980 25105 | ||
| Instability index: | 71.523 | ||
| aromaticity | 0.052 | ||
| GRAVY | -0.706 | ||
Secondary Structure Fraction | |||
| Helix | 0.104 | ||
| turn | 0.504 | ||
| sheet | 0.139 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY338146.1 | complete | 116 | 68-418(+) |
Amino Acid sequence : | |||
| MMWWXSWCPSLSKAISTSSSTSAASSPPATSPSTTSAPPPTTARRGAGSKGGTQYPLPTSNSTNSNHSPSSPIPQTPTHQSSSHHTSNHCLTPCTYSADPSAASWRISPPGPAGSS* | |||
Physicochemical properties | |||
| Number of amino acids: | 116 | ||
| Molecular weight: | 11,707.567 | ||
| Theoretical pI: | 9.417 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 24980 25105 | ||
| Instability index: | 71.523 | ||
| aromaticity | 0.052 | ||
| GRAVY | -0.706 | ||
Secondary Structure Fraction | |||
| Helix | 0.104 | ||
| turn | 0.504 | ||
| sheet | 0.139 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY338146.1 | 3prime_partial | 197 | 85-675(+) |
Amino Acid sequence : | |||
| MVPFPLQGHLNQLLHLCRLIAARDVPVHYVGTATHNRQARRRIQGWDPISTSNIKFHEFQPLSFISNPPDPDASIKFPSHLQPLFDTLHLLRRPISGLLEDLSSRARRVIVIYDSLMGSV VQDFVRFPNAESYIFHSVSAYTIFFFLWETNGRPFAIEPEILASLPSLEGCFTPEFLKFVVKQHKYLKLNSGRIYNT | |||
Physicochemical properties | |||
| Number of amino acids: | 197 | ||
| Molecular weight: | 11,707.567 | ||
| Theoretical pI: | 9.417 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 24980 25105 | ||
| Instability index: | 71.523 | ||
| aromaticity | 0.052 | ||
| GRAVY | -0.706 | ||
Secondary Structure Fraction | |||
| Helix | 0.104 | ||
| turn | 0.504 | ||
| sheet | 0.139 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY338146.1 | complete | 116 | 68-418(+) |
Amino Acid sequence : | |||
| MMWWXSWCPSLSKAISTSSSTSAASSPPATSPSTTSAPPPTTARRGAGSKGGTQYPLPTSNSTNSNHSPSSPIPQTPTHQSSSHHTSNHCLTPCTYSADPSAASWRISPPGPAGSS* | |||
Physicochemical properties | |||
| Number of amino acids: | 116 | ||
| Molecular weight: | 11,707.567 | ||
| Theoretical pI: | 9.417 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 24980 25105 | ||
| Instability index: | 71.523 | ||
| aromaticity | 0.052 | ||
| GRAVY | -0.706 | ||
Secondary Structure Fraction | |||
| Helix | 0.104 | ||
| turn | 0.504 | ||
| sheet | 0.139 | ||