Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY338148.1 | complete | 150 | 1-453(+) |
Amino Acid sequence : | |||
MKLALLSGAYMMLATTSLVGILGDPITKQDFDWITNEPPILRAASVICRLMDDVVGHGIEQKISSVDCYMKENGCSKMEAVGEFSKQVKKAWKNLNEEWVEPRAASMVILVRVVNLARVI NLLYVGEDSYGNSSVKTKELIKCVLVDPIK* | |||
Physicochemical properties | |||
Number of amino acids: | 150 | ||
Molecular weight: | 16,634.393 | ||
Theoretical pI: | 6.582 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 22460 22710 | ||
Instability index: | 26.517 | ||
aromaticity | 0.060 | ||
GRAVY | 0.124 | ||
Secondary Structure Fraction | |||
Helix | 0.347 | ||
turn | 0.213 | ||
sheet | 0.280 |