Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY338150.1 | internal | 236 | 1-708(+) |
Amino Acid sequence : | |||
KNLSCPSLEVDEMADTFLFTSESVNEGHPDKLCDQISDAVLDACLEQDPDSKVACETCTKTNMVMVFGEITTKANIDYEKIVRDTCRSIGFVSDDVGLDADKCKVLVNIEQQSPDIAQGV HGHLTKRPEEIGAGDQGHMFGYATDETPEYMPLSHVLATKLGARLTEVRKDGTCPWLRPDGKTQVTVEYYNENGAMVPIRVHTVLISTQHDETVTNDEIARDLQEHVIKPVIPAKY | |||
Physicochemical properties | |||
Number of amino acids: | 236 | ||
Molecular weight: | 16,617.135 | ||
Theoretical pI: | 7.140 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 2980 2980 | ||
Instability index: | 23.250 | ||
aromaticity | 0.039 | ||
GRAVY | 0.330 | ||
Secondary Structure Fraction | |||
Helix | 0.374 | ||
turn | 0.206 | ||
sheet | 0.303 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY338150.1 | 3prime_partial | 155 | 465-1(-) |
Amino Acid sequence : | |||
MTKRHVLRGFVSGVPKHVALVTGPDLLRAFGQMAVNALSDIRALLLDVDKNLALVSIETNVVGNKPYRAAGVAHDLLVVYVGLGCDLSKDHHHVGLGASLTSHLAIGILLEASIENRVGD LIAELVGVPLVHALGGKQEGVRHFVDLERRTREVF | |||
Physicochemical properties | |||
Number of amino acids: | 155 | ||
Molecular weight: | 16,617.135 | ||
Theoretical pI: | 7.140 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 2980 2980 | ||
Instability index: | 23.250 | ||
aromaticity | 0.039 | ||
GRAVY | 0.330 | ||
Secondary Structure Fraction | |||
Helix | 0.374 | ||
turn | 0.206 | ||
sheet | 0.303 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY338150.1 | internal | 236 | 1-708(+) |
Amino Acid sequence : | |||
KNLSCPSLEVDEMADTFLFTSESVNEGHPDKLCDQISDAVLDACLEQDPDSKVACETCTKTNMVMVFGEITTKANIDYEKIVRDTCRSIGFVSDDVGLDADKCKVLVNIEQQSPDIAQGV HGHLTKRPEEIGAGDQGHMFGYATDETPEYMPLSHVLATKLGARLTEVRKDGTCPWLRPDGKTQVTVEYYNENGAMVPIRVHTVLISTQHDETVTNDEIARDLQEHVIKPVIPAKY | |||
Physicochemical properties | |||
Number of amino acids: | 236 | ||
Molecular weight: | 16,617.135 | ||
Theoretical pI: | 7.140 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 2980 2980 | ||
Instability index: | 23.250 | ||
aromaticity | 0.039 | ||
GRAVY | 0.330 | ||
Secondary Structure Fraction | |||
Helix | 0.374 | ||
turn | 0.206 | ||
sheet | 0.303 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY338150.1 | 3prime_partial | 155 | 465-1(-) |
Amino Acid sequence : | |||
MTKRHVLRGFVSGVPKHVALVTGPDLLRAFGQMAVNALSDIRALLLDVDKNLALVSIETNVVGNKPYRAAGVAHDLLVVYVGLGCDLSKDHHHVGLGASLTSHLAIGILLEASIENRVGD LIAELVGVPLVHALGGKQEGVRHFVDLERRTREVF | |||
Physicochemical properties | |||
Number of amino acids: | 155 | ||
Molecular weight: | 16,617.135 | ||
Theoretical pI: | 7.140 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 2980 2980 | ||
Instability index: | 23.250 | ||
aromaticity | 0.039 | ||
GRAVY | 0.330 | ||
Secondary Structure Fraction | |||
Helix | 0.374 | ||
turn | 0.206 | ||
sheet | 0.303 |