Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY338151.1 | 5prime_partial | 186 | 778-218(-) |
Amino Acid sequence : | |||
GISRSTSSSRVIPAKYLDEKTIFHLNPSGRFVIGGPHGDAGLTGRKIIIDTYGGWGAHGGGAFSGKDPTKVDRSGAYIVRQAAKSIVANGLARRCIVQVSYAIGVPEPLSVFVDSYGTGK IPDKEILKIVKESFDFRPGMISINLDLKRGSNGRFLKTAAYGHFGRDDPDFTWEVVKPLKWEKPQS* | |||
Physicochemical properties | |||
Number of amino acids: | 186 | ||
Molecular weight: | 16,241.967 | ||
Theoretical pI: | 4.716 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 0 0 | ||
Instability index: | 47.886 | ||
aromaticity | 0.006 | ||
GRAVY | -0.416 | ||
Secondary Structure Fraction | |||
Helix | 0.258 | ||
turn | 0.284 | ||
sheet | 0.245 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY338151.1 | complete | 155 | 290-757(+) |
Amino Acid sequence : | |||
MPVRSGLQEPPVAPPLQVEVDRDHPRPEVEALLHDLQDLLVGDLPRPVGVDKHRQRLRHTDGVRHLHDAPPGEPVGDNALGRLPHDVGATPVDLGGVLPGEGPAAVGPPPAVGVDDDLTA GETRVAVGPTDDETPGGIKVEDGFLVQILRGDHPA* | |||
Physicochemical properties | |||
Number of amino acids: | 155 | ||
Molecular weight: | 16,241.967 | ||
Theoretical pI: | 4.716 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 0 0 | ||
Instability index: | 47.886 | ||
aromaticity | 0.006 | ||
GRAVY | -0.416 | ||
Secondary Structure Fraction | |||
Helix | 0.258 | ||
turn | 0.284 | ||
sheet | 0.245 |