| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY338164.1 | internal | 247 | 3-743(+) |
Amino Acid sequence : | |||
| LLRHNGIEIPSEIFLKFKDERGKFDESDTLGLLSLYEASNLGVAGEEILEEAMEFAEARLRRSLSEPAAPLHGEVAQALDVPRHLRMARLEARRFIEQYGKQSDHDGDLLELAILDYNQV QAQHQSELTEIIRWWKELGLVDKLSFGRDRPLECFLWTVGLLPEPKYSSVRIELAKAISILLVIDDIFDTYGEMDDLILFTDAIRRWDLEAMEGLPEYMKICYMALYNTTNEVCYKVLRD TGRIVLL | |||
Physicochemical properties | |||
| Number of amino acids: | 247 | ||
| Molecular weight: | 28,479.323 | ||
| Theoretical pI: | 4.740 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 35410 35535 | ||
| Instability index: | 56.570 | ||
| aromaticity | 0.089 | ||
| GRAVY | -0.165 | ||
Secondary Structure Fraction | |||
| Helix | 0.356 | ||
| turn | 0.158 | ||
| sheet | 0.360 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY338164.1 | internal | 247 | 3-743(+) |
Amino Acid sequence : | |||
| LLRHNGIEIPSEIFLKFKDERGKFDESDTLGLLSLYEASNLGVAGEEILEEAMEFAEARLRRSLSEPAAPLHGEVAQALDVPRHLRMARLEARRFIEQYGKQSDHDGDLLELAILDYNQV QAQHQSELTEIIRWWKELGLVDKLSFGRDRPLECFLWTVGLLPEPKYSSVRIELAKAISILLVIDDIFDTYGEMDDLILFTDAIRRWDLEAMEGLPEYMKICYMALYNTTNEVCYKVLRD TGRIVLL | |||
Physicochemical properties | |||
| Number of amino acids: | 247 | ||
| Molecular weight: | 28,479.323 | ||
| Theoretical pI: | 4.740 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 35410 35535 | ||
| Instability index: | 56.570 | ||
| aromaticity | 0.089 | ||
| GRAVY | -0.165 | ||
Secondary Structure Fraction | |||
| Helix | 0.356 | ||
| turn | 0.158 | ||
| sheet | 0.360 | ||