| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY338187.1 | 5prime_partial | 187 | 750-187(-) |
Amino Acid sequence : | |||
| VSADHADGKPLPAAQNHQETPTPEILTSSKEIHVVEDDDEEKEKKKRISSAADEFATNKRDERSKKGGEYSPTIKQKRGGHETWTKQRKLWHSMSLPLPKEAAAGGEAVGGEIDSMFGAV IVMVTLIVMIIWGKVCAILCAAAWLYFVPRFRANNAIKFKNNGLDFDSREHKKMVVLQGLLQRNPPQ* | |||
Physicochemical properties | |||
| Number of amino acids: | 187 | ||
| Molecular weight: | 12,729.675 | ||
| Theoretical pI: | 5.410 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 6990 7240 | ||
| Instability index: | 61.099 | ||
| aromaticity | 0.100 | ||
| GRAVY | 0.806 | ||
Secondary Structure Fraction | |||
| Helix | 0.375 | ||
| turn | 0.333 | ||
| sheet | 0.233 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY338187.1 | complete | 120 | 338-700(+) |
Amino Acid sequence : | |||
| MAQTLPQIIITINVTITITAPNMESISPPTASPPAAASFGSGRDIECHSFRCFVHVSCPPLFCFIVGLYSPPFLLLSSLLLVANSSAAELILFFFSFSSSSSSTTWISLLEVRISGVGVS * | |||
Physicochemical properties | |||
| Number of amino acids: | 120 | ||
| Molecular weight: | 12,729.675 | ||
| Theoretical pI: | 5.410 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 6990 7240 | ||
| Instability index: | 61.099 | ||
| aromaticity | 0.100 | ||
| GRAVY | 0.806 | ||
Secondary Structure Fraction | |||
| Helix | 0.375 | ||
| turn | 0.333 | ||
| sheet | 0.233 | ||