Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY338199.1 | 5prime_partial | 201 | 666-61(-) |
Amino Acid sequence : | |||
EYKDLPAFFVGESMGGLLTMLMYFQSAEEDLWTGLIFSAPLFVFPEPMVPFKVHIFMYGLLFGLADTWAAMPDNKMVGKAIKDPEKLKVIASNPMRYPGKPRVGTMRELVRQTDYVQRNF DKVKAPFLTLHGTSDGLAEASGSEMLYQKASSEDKTLKLYEGMYPFLVQGEPDENANLVLADMRAWIDARVERYGSNCSAN* | |||
Physicochemical properties | |||
Number of amino acids: | 201 | ||
Molecular weight: | 18,264.248 | ||
Theoretical pI: | 11.512 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 5500 5625 | ||
Instability index: | 55.776 | ||
aromaticity | 0.031 | ||
GRAVY | -0.156 | ||
Secondary Structure Fraction | |||
Helix | 0.333 | ||
turn | 0.259 | ||
sheet | 0.191 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY338199.1 | 5prime_partial | 162 | 1-489(+) |
Amino Acid sequence : | |||
RNTSKKTLAFVKNQPMLREWLICTTVGTISLNSSINPSPHISQHKISILIRLTLHQKGIHPFIQFQSLVLTAGLLVQHLRPRRLSQPIRGPVQSQEGRLDLVKIPLHVIRLPHQLPHRPH SGLPGVPHRVARDHLQLLGIFDGLPHHLVVRHCSPCVGQSEQ* | |||
Physicochemical properties | |||
Number of amino acids: | 162 | ||
Molecular weight: | 18,264.248 | ||
Theoretical pI: | 11.512 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 5500 5625 | ||
Instability index: | 55.776 | ||
aromaticity | 0.031 | ||
GRAVY | -0.156 | ||
Secondary Structure Fraction | |||
Helix | 0.333 | ||
turn | 0.259 | ||
sheet | 0.191 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY338199.1 | 5prime_partial | 201 | 666-61(-) |
Amino Acid sequence : | |||
EYKDLPAFFVGESMGGLLTMLMYFQSAEEDLWTGLIFSAPLFVFPEPMVPFKVHIFMYGLLFGLADTWAAMPDNKMVGKAIKDPEKLKVIASNPMRYPGKPRVGTMRELVRQTDYVQRNF DKVKAPFLTLHGTSDGLAEASGSEMLYQKASSEDKTLKLYEGMYPFLVQGEPDENANLVLADMRAWIDARVERYGSNCSAN* | |||
Physicochemical properties | |||
Number of amino acids: | 201 | ||
Molecular weight: | 18,264.248 | ||
Theoretical pI: | 11.512 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 5500 5625 | ||
Instability index: | 55.776 | ||
aromaticity | 0.031 | ||
GRAVY | -0.156 | ||
Secondary Structure Fraction | |||
Helix | 0.333 | ||
turn | 0.259 | ||
sheet | 0.191 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY338199.1 | 5prime_partial | 162 | 1-489(+) |
Amino Acid sequence : | |||
RNTSKKTLAFVKNQPMLREWLICTTVGTISLNSSINPSPHISQHKISILIRLTLHQKGIHPFIQFQSLVLTAGLLVQHLRPRRLSQPIRGPVQSQEGRLDLVKIPLHVIRLPHQLPHRPH SGLPGVPHRVARDHLQLLGIFDGLPHHLVVRHCSPCVGQSEQ* | |||
Physicochemical properties | |||
Number of amino acids: | 162 | ||
Molecular weight: | 18,264.248 | ||
Theoretical pI: | 11.512 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 5500 5625 | ||
Instability index: | 55.776 | ||
aromaticity | 0.031 | ||
GRAVY | -0.156 | ||
Secondary Structure Fraction | |||
Helix | 0.333 | ||
turn | 0.259 | ||
sheet | 0.191 |