| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY338200.1 | internal | 147 | 1-441(+) |
Amino Acid sequence : | |||
| PPPPPLPESNHPRRKMSPENPPQPPPYFWGGTPEDEYYASQGVRNSKSYFQTPHGRLFTQSFLPLDPTRPVKASVFMTHGYGSDTSWMFQKFCINFASWGYAVFAADMLGHGRSDGIRGY IGDMNKVAAASLSFFTSVRVSEEYKDL | |||
Physicochemical properties | |||
| Number of amino acids: | 147 | ||
| Molecular weight: | 14,163.331 | ||
| Theoretical pI: | 12.000 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 2980 2980 | ||
| Instability index: | 87.944 | ||
| aromaticity | 0.016 | ||
| GRAVY | -0.820 | ||
Secondary Structure Fraction | |||
| Helix | 0.250 | ||
| turn | 0.266 | ||
| sheet | 0.258 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY338200.1 | 5prime_partial | 130 | 441-49(-) |
Amino Acid sequence : | |||
| QILVLLANPNAREEGQRSRRHLIHVADVAADPVGAAVPQHIGGEHGVAPAGEVDAEFLEHPARIRPVPVGHEDGGLHGPGRVEGEEGLGEEPPVWGLEVGFGVADALGGVVFVLRRAAPE VWRRLRGVFR* | |||
Physicochemical properties | |||
| Number of amino acids: | 130 | ||
| Molecular weight: | 14,163.331 | ||
| Theoretical pI: | 12.000 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 2980 2980 | ||
| Instability index: | 87.944 | ||
| aromaticity | 0.016 | ||
| GRAVY | -0.820 | ||
Secondary Structure Fraction | |||
| Helix | 0.250 | ||
| turn | 0.266 | ||
| sheet | 0.258 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY338200.1 | 5prime_partial | 124 | 3-377(+) |
Amino Acid sequence : | |||
| TTTASSRIQPPPPQNVTGKPPSAAAILLGRHAGGRILRLPRRPQLQILLPNPTREALHPILPPPRPDPAREGLRLHDPRVRVGYELDVPEILHQLRQLGLRRVRRRYAGARPLRRDPRLH RRHE* | |||
Physicochemical properties | |||
| Number of amino acids: | 124 | ||
| Molecular weight: | 14,163.331 | ||
| Theoretical pI: | 12.000 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 2980 2980 | ||
| Instability index: | 87.944 | ||
| aromaticity | 0.016 | ||
| GRAVY | -0.820 | ||
Secondary Structure Fraction | |||
| Helix | 0.250 | ||
| turn | 0.266 | ||
| sheet | 0.258 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY338200.1 | internal | 147 | 1-441(+) |
Amino Acid sequence : | |||
| PPPPPLPESNHPRRKMSPENPPQPPPYFWGGTPEDEYYASQGVRNSKSYFQTPHGRLFTQSFLPLDPTRPVKASVFMTHGYGSDTSWMFQKFCINFASWGYAVFAADMLGHGRSDGIRGY IGDMNKVAAASLSFFTSVRVSEEYKDL | |||
Physicochemical properties | |||
| Number of amino acids: | 147 | ||
| Molecular weight: | 14,163.331 | ||
| Theoretical pI: | 12.000 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 2980 2980 | ||
| Instability index: | 87.944 | ||
| aromaticity | 0.016 | ||
| GRAVY | -0.820 | ||
Secondary Structure Fraction | |||
| Helix | 0.250 | ||
| turn | 0.266 | ||
| sheet | 0.258 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY338200.1 | 5prime_partial | 130 | 441-49(-) |
Amino Acid sequence : | |||
| QILVLLANPNAREEGQRSRRHLIHVADVAADPVGAAVPQHIGGEHGVAPAGEVDAEFLEHPARIRPVPVGHEDGGLHGPGRVEGEEGLGEEPPVWGLEVGFGVADALGGVVFVLRRAAPE VWRRLRGVFR* | |||
Physicochemical properties | |||
| Number of amino acids: | 130 | ||
| Molecular weight: | 14,163.331 | ||
| Theoretical pI: | 12.000 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 2980 2980 | ||
| Instability index: | 87.944 | ||
| aromaticity | 0.016 | ||
| GRAVY | -0.820 | ||
Secondary Structure Fraction | |||
| Helix | 0.250 | ||
| turn | 0.266 | ||
| sheet | 0.258 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY338200.1 | 5prime_partial | 124 | 3-377(+) |
Amino Acid sequence : | |||
| TTTASSRIQPPPPQNVTGKPPSAAAILLGRHAGGRILRLPRRPQLQILLPNPTREALHPILPPPRPDPAREGLRLHDPRVRVGYELDVPEILHQLRQLGLRRVRRRYAGARPLRRDPRLH RRHE* | |||
Physicochemical properties | |||
| Number of amino acids: | 124 | ||
| Molecular weight: | 14,163.331 | ||
| Theoretical pI: | 12.000 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 2980 2980 | ||
| Instability index: | 87.944 | ||
| aromaticity | 0.016 | ||
| GRAVY | -0.820 | ||
Secondary Structure Fraction | |||
| Helix | 0.250 | ||
| turn | 0.266 | ||
| sheet | 0.258 | ||