| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY338203.1 | internal | 164 | 3-494(+) |
Amino Acid sequence : | |||
| GSWMTLRLLPDGYSVNATIRLHPERKRDIIYITNLPGAAERLQIFNADLDKPETFVPAIQGCSGVFHMAHPLDFAEKESEEVKLKRVTAGLQGILQACADSNTVRRVVYTSSICAAAFGS ATNSDGLVDDNSGTDVDLIRRLKTFRGPYIVRKTLTEKAAIDLG | |||
Physicochemical properties | |||
| Number of amino acids: | 164 | ||
| Molecular weight: | 17,965.284 | ||
| Theoretical pI: | 7.014 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 11460 11585 | ||
| Instability index: | 35.779 | ||
| aromaticity | 0.067 | ||
| GRAVY | -0.152 | ||
Secondary Structure Fraction | |||
| Helix | 0.299 | ||
| turn | 0.213 | ||
| sheet | 0.256 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY338203.1 | internal | 164 | 3-494(+) |
Amino Acid sequence : | |||
| GSWMTLRLLPDGYSVNATIRLHPERKRDIIYITNLPGAAERLQIFNADLDKPETFVPAIQGCSGVFHMAHPLDFAEKESEEVKLKRVTAGLQGILQACADSNTVRRVVYTSSICAAAFGS ATNSDGLVDDNSGTDVDLIRRLKTFRGPYIVRKTLTEKAAIDLG | |||
Physicochemical properties | |||
| Number of amino acids: | 164 | ||
| Molecular weight: | 17,965.284 | ||
| Theoretical pI: | 7.014 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 11460 11585 | ||
| Instability index: | 35.779 | ||
| aromaticity | 0.067 | ||
| GRAVY | -0.152 | ||
Secondary Structure Fraction | |||
| Helix | 0.299 | ||
| turn | 0.213 | ||
| sheet | 0.256 | ||