Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY338207.1 | 5prime_partial | 179 | 656-117(-) |
Amino Acid sequence : | |||
KKKKDENKNLWAEDYPVGSALRAGKSASGIILRVSKSVTATRFEKTGHIRGPALSSVAAILRRFEHSARVLAAAVHLQLAGAIRYDVLRRALDGARAAVSRRRHLDRQIVAVNDGAVVVV LPPEVVEAVLRLGVRRRAEGGAVELAAAVAGEACALAGGIEGAVGAGPDFGEFGAVLEG* | |||
Physicochemical properties | |||
Number of amino acids: | 179 | ||
Molecular weight: | 12,542.640 | ||
Theoretical pI: | 12.000 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 0 0 | ||
Instability index: | 100.065 | ||
aromaticity | 0.009 | ||
GRAVY | -1.100 | ||
Secondary Structure Fraction | |||
Helix | 0.217 | ||
turn | 0.226 | ||
sheet | 0.274 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY338207.1 | 5prime_partial | 115 | 1-348(+) |
Amino Acid sequence : | |||
ARGKRHPTSTSKTNAPPRSGRPSSPTAAAAASTAAKPGPYPSKTAPNSPKSGPAPTAPSIPPARAHASPATAAASSTAPPSARRRTPRRSTASTTSGGRTTTTAPSLTATICRSR* | |||
Physicochemical properties | |||
Number of amino acids: | 115 | ||
Molecular weight: | 12,542.640 | ||
Theoretical pI: | 12.000 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 0 0 | ||
Instability index: | 100.065 | ||
aromaticity | 0.009 | ||
GRAVY | -1.100 | ||
Secondary Structure Fraction | |||
Helix | 0.217 | ||
turn | 0.226 | ||
sheet | 0.274 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY338207.1 | 5prime_partial | 106 | 2-322(+) |
Amino Acid sequence : | |||
HAVNAIRLRHPKQMLLHDLAGRPPPRRRPPPRQRPNLDPILPKRPQTRQSLGPHQLHLRFLRQGHMPHRRLRRPAQLHHLRLAAAHQGGVRPQRLRAEGLLRRLRH* | |||
Physicochemical properties | |||
Number of amino acids: | 106 | ||
Molecular weight: | 12,542.640 | ||
Theoretical pI: | 12.000 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 0 0 | ||
Instability index: | 100.065 | ||
aromaticity | 0.009 | ||
GRAVY | -1.100 | ||
Secondary Structure Fraction | |||
Helix | 0.217 | ||
turn | 0.226 | ||
sheet | 0.274 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY338207.1 | 5prime_partial | 179 | 656-117(-) |
Amino Acid sequence : | |||
KKKKDENKNLWAEDYPVGSALRAGKSASGIILRVSKSVTATRFEKTGHIRGPALSSVAAILRRFEHSARVLAAAVHLQLAGAIRYDVLRRALDGARAAVSRRRHLDRQIVAVNDGAVVVV LPPEVVEAVLRLGVRRRAEGGAVELAAAVAGEACALAGGIEGAVGAGPDFGEFGAVLEG* | |||
Physicochemical properties | |||
Number of amino acids: | 179 | ||
Molecular weight: | 12,542.640 | ||
Theoretical pI: | 12.000 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 0 0 | ||
Instability index: | 100.065 | ||
aromaticity | 0.009 | ||
GRAVY | -1.100 | ||
Secondary Structure Fraction | |||
Helix | 0.217 | ||
turn | 0.226 | ||
sheet | 0.274 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY338207.1 | 5prime_partial | 115 | 1-348(+) |
Amino Acid sequence : | |||
ARGKRHPTSTSKTNAPPRSGRPSSPTAAAAASTAAKPGPYPSKTAPNSPKSGPAPTAPSIPPARAHASPATAAASSTAPPSARRRTPRRSTASTTSGGRTTTTAPSLTATICRSR* | |||
Physicochemical properties | |||
Number of amino acids: | 115 | ||
Molecular weight: | 12,542.640 | ||
Theoretical pI: | 12.000 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 0 0 | ||
Instability index: | 100.065 | ||
aromaticity | 0.009 | ||
GRAVY | -1.100 | ||
Secondary Structure Fraction | |||
Helix | 0.217 | ||
turn | 0.226 | ||
sheet | 0.274 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY338207.1 | 5prime_partial | 106 | 2-322(+) |
Amino Acid sequence : | |||
HAVNAIRLRHPKQMLLHDLAGRPPPRRRPPPRQRPNLDPILPKRPQTRQSLGPHQLHLRFLRQGHMPHRRLRRPAQLHHLRLAAAHQGGVRPQRLRAEGLLRRLRH* | |||
Physicochemical properties | |||
Number of amino acids: | 106 | ||
Molecular weight: | 12,542.640 | ||
Theoretical pI: | 12.000 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 0 0 | ||
Instability index: | 100.065 | ||
aromaticity | 0.009 | ||
GRAVY | -1.100 | ||
Secondary Structure Fraction | |||
Helix | 0.217 | ||
turn | 0.226 | ||
sheet | 0.274 |