| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY338208.1 | 5prime_partial | 223 | 822-151(-) |
Amino Acid sequence : | |||
| VDEPSKYGVVVMEESTGQVEKFVEKPKLFVGNKINAGIYLLNPSVLDLIELRPTSIEKEVFPKIAAQKNLYAMVLPGFWMDIGQPKDYITGLRLYLDSLRKKSSPTLASGAHVIGNVLVD ETAKIGEGCLIGPDVAIGPGCIVESGVRLSRCTVMRGVRIKKHACISSSIIGWHSTVGQWARVENMMILGEDVHVGDEVYSNGGVVLPHKEIKSSILKPEIVM* | |||
Physicochemical properties | |||
| Number of amino acids: | 223 | ||
| Molecular weight: | 24,312.164 | ||
| Theoretical pI: | 7.103 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 25440 25690 | ||
| Instability index: | 35.894 | ||
| aromaticity | 0.058 | ||
| GRAVY | 0.101 | ||
Secondary Structure Fraction | |||
| Helix | 0.350 | ||
| turn | 0.260 | ||
| sheet | 0.233 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY338208.1 | 5prime_partial | 223 | 822-151(-) |
Amino Acid sequence : | |||
| VDEPSKYGVVVMEESTGQVEKFVEKPKLFVGNKINAGIYLLNPSVLDLIELRPTSIEKEVFPKIAAQKNLYAMVLPGFWMDIGQPKDYITGLRLYLDSLRKKSSPTLASGAHVIGNVLVD ETAKIGEGCLIGPDVAIGPGCIVESGVRLSRCTVMRGVRIKKHACISSSIIGWHSTVGQWARVENMMILGEDVHVGDEVYSNGGVVLPHKEIKSSILKPEIVM* | |||
Physicochemical properties | |||
| Number of amino acids: | 223 | ||
| Molecular weight: | 24,312.164 | ||
| Theoretical pI: | 7.103 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 25440 25690 | ||
| Instability index: | 35.894 | ||
| aromaticity | 0.058 | ||
| GRAVY | 0.101 | ||
Secondary Structure Fraction | |||
| Helix | 0.350 | ||
| turn | 0.260 | ||
| sheet | 0.233 | ||