Acc_NO	ORF type	length	start-end position (strand +/-)
>DY338235.1	complete	207	32-655(+)
Amino Acid sequence :
MALHQDVSFLASLLVLGLMCLHVSAEIDQDRDIINLKPCTRECGNFSYAICPRSEGSPRTPICTTCCAGYKGCKYYNANGTFICEGQSDPRKPNERCPKECDRKIAYSKCPRSEGPTIIK PTGCTTCCTGYKGCYYYGKDNKFVCEGQSNEPKVCTQQCDLKVAYMTCPPESTKLTRVCVNCCTAKPGCKLYGHDGSLICIGGVKPL*
Physicochemical properties
Number of amino acids:		207
Molecular weight:		22,671.117
Theoretical pI:		8.431
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		16390 17890
Instability index:		42.848
aromaticity		0.072
GRAVY		-0.315
Secondary Structure Fraction
Helix		0.232
turn		0.256
sheet		0.169