Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY338236.1 | internal | 243 | 2-730(+) |
Amino Acid sequence : | |||
HAVMNIDEGVAEWEAALPSVDDLTPLSQCLIPAELASAFRISTEPSRTALDVGRASQSTISSICGGSVHSTETATSFKPFSGHVDDHVMAEVDTDEGSDPKKSRRMESADDPAVDNCMDD QSTAAAKTLKRPRLVWTPQLHKRFVDVVAHLGLKNAVPKTIMQLMNVEGLTRENVASHLQKYRLYVKRMQGLSNEGPSPSDHLFASTPLPPQSFNESSSAGPSLGNGIANGSHGSVNGSI ANN | |||
Physicochemical properties | |||
Number of amino acids: | 243 | ||
Molecular weight: | 25,944.632 | ||
Theoretical pI: | 5.551 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 13980 14105 | ||
Instability index: | 39.350 | ||
aromaticity | 0.041 | ||
GRAVY | -0.396 | ||
Secondary Structure Fraction | |||
Helix | 0.226 | ||
turn | 0.305 | ||
sheet | 0.255 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY338236.1 | internal | 243 | 2-730(+) |
Amino Acid sequence : | |||
HAVMNIDEGVAEWEAALPSVDDLTPLSQCLIPAELASAFRISTEPSRTALDVGRASQSTISSICGGSVHSTETATSFKPFSGHVDDHVMAEVDTDEGSDPKKSRRMESADDPAVDNCMDD QSTAAAKTLKRPRLVWTPQLHKRFVDVVAHLGLKNAVPKTIMQLMNVEGLTRENVASHLQKYRLYVKRMQGLSNEGPSPSDHLFASTPLPPQSFNESSSAGPSLGNGIANGSHGSVNGSI ANN | |||
Physicochemical properties | |||
Number of amino acids: | 243 | ||
Molecular weight: | 25,944.632 | ||
Theoretical pI: | 5.551 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 13980 14105 | ||
Instability index: | 39.350 | ||
aromaticity | 0.041 | ||
GRAVY | -0.396 | ||
Secondary Structure Fraction | |||
Helix | 0.226 | ||
turn | 0.305 | ||
sheet | 0.255 |