Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY338240.1 | internal | 236 | 1-708(+) |
Amino Acid sequence : | |||
ARRFNPTTKLPHTICAIDVHGGRRYRSVLSSRANFCVSAILTQTKESSTSSQFDIKKYMVEKENSVNRALEAAIQLKEPVEIHESMRYSLLAGGKRVRPILCITACELVGGEESTAMPAA CAVEMIQTMSLMHDDLPFMDNDDLRRGKPTNHKVFGENAAVLAGDAMLSFAFEHVAAATRGVAPERVVRAVRELANLIGSEGLSGGQVVDVSSEGMAAVGLDHLELIHRLKTAALV | |||
Physicochemical properties | |||
Number of amino acids: | 236 | ||
Molecular weight: | 11,627.056 | ||
Theoretical pI: | 11.845 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 0 0 | ||
Instability index: | 76.368 | ||
aromaticity | 0.010 | ||
GRAVY | -0.927 | ||
Secondary Structure Fraction | |||
Helix | 0.250 | ||
turn | 0.180 | ||
sheet | 0.220 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY338240.1 | complete | 147 | 500-57(-) |
Amino Acid sequence : | |||
MASPASTAAFSPNTLWLVGFPRRRSSLSMKGRSSCIRDMVWIISTAQAAGMAVDSSPPTSSQAVMQRIGRTLLPPARREYLMDSWISTGSFSWIAASNALFTEFSFSTMYFLISNCEEVD DSLVWVRIAETQKLARDERTDLYLRPP* | |||
Physicochemical properties | |||
Number of amino acids: | 147 | ||
Molecular weight: | 11,627.056 | ||
Theoretical pI: | 11.845 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 0 0 | ||
Instability index: | 76.368 | ||
aromaticity | 0.010 | ||
GRAVY | -0.927 | ||
Secondary Structure Fraction | |||
Helix | 0.250 | ||
turn | 0.180 | ||
sheet | 0.220 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY338240.1 | 5prime_partial | 100 | 708-406(-) |
Amino Acid sequence : | |||
HQRRRLQAVDQLQVIESHSRHPLRTDVHHLTPRQPLRPDQIRQLPHRPHHSLRRHAPRRGGHVFERERQHGVAGQHRRVLAEHLVVGGLPAAEVVVVHEG* | |||
Physicochemical properties | |||
Number of amino acids: | 100 | ||
Molecular weight: | 11,627.056 | ||
Theoretical pI: | 11.845 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 0 0 | ||
Instability index: | 76.368 | ||
aromaticity | 0.010 | ||
GRAVY | -0.927 | ||
Secondary Structure Fraction | |||
Helix | 0.250 | ||
turn | 0.180 | ||
sheet | 0.220 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY338240.1 | internal | 236 | 1-708(+) |
Amino Acid sequence : | |||
ARRFNPTTKLPHTICAIDVHGGRRYRSVLSSRANFCVSAILTQTKESSTSSQFDIKKYMVEKENSVNRALEAAIQLKEPVEIHESMRYSLLAGGKRVRPILCITACELVGGEESTAMPAA CAVEMIQTMSLMHDDLPFMDNDDLRRGKPTNHKVFGENAAVLAGDAMLSFAFEHVAAATRGVAPERVVRAVRELANLIGSEGLSGGQVVDVSSEGMAAVGLDHLELIHRLKTAALV | |||
Physicochemical properties | |||
Number of amino acids: | 236 | ||
Molecular weight: | 11,627.056 | ||
Theoretical pI: | 11.845 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 0 0 | ||
Instability index: | 76.368 | ||
aromaticity | 0.010 | ||
GRAVY | -0.927 | ||
Secondary Structure Fraction | |||
Helix | 0.250 | ||
turn | 0.180 | ||
sheet | 0.220 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY338240.1 | complete | 147 | 500-57(-) |
Amino Acid sequence : | |||
MASPASTAAFSPNTLWLVGFPRRRSSLSMKGRSSCIRDMVWIISTAQAAGMAVDSSPPTSSQAVMQRIGRTLLPPARREYLMDSWISTGSFSWIAASNALFTEFSFSTMYFLISNCEEVD DSLVWVRIAETQKLARDERTDLYLRPP* | |||
Physicochemical properties | |||
Number of amino acids: | 147 | ||
Molecular weight: | 11,627.056 | ||
Theoretical pI: | 11.845 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 0 0 | ||
Instability index: | 76.368 | ||
aromaticity | 0.010 | ||
GRAVY | -0.927 | ||
Secondary Structure Fraction | |||
Helix | 0.250 | ||
turn | 0.180 | ||
sheet | 0.220 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY338240.1 | 5prime_partial | 100 | 708-406(-) |
Amino Acid sequence : | |||
HQRRRLQAVDQLQVIESHSRHPLRTDVHHLTPRQPLRPDQIRQLPHRPHHSLRRHAPRRGGHVFERERQHGVAGQHRRVLAEHLVVGGLPAAEVVVVHEG* | |||
Physicochemical properties | |||
Number of amino acids: | 100 | ||
Molecular weight: | 11,627.056 | ||
Theoretical pI: | 11.845 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 0 0 | ||
Instability index: | 76.368 | ||
aromaticity | 0.010 | ||
GRAVY | -0.927 | ||
Secondary Structure Fraction | |||
Helix | 0.250 | ||
turn | 0.180 | ||
sheet | 0.220 |