| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY338240.1 | internal | 236 | 1-708(+) |
Amino Acid sequence : | |||
| ARRFNPTTKLPHTICAIDVHGGRRYRSVLSSRANFCVSAILTQTKESSTSSQFDIKKYMVEKENSVNRALEAAIQLKEPVEIHESMRYSLLAGGKRVRPILCITACELVGGEESTAMPAA CAVEMIQTMSLMHDDLPFMDNDDLRRGKPTNHKVFGENAAVLAGDAMLSFAFEHVAAATRGVAPERVVRAVRELANLIGSEGLSGGQVVDVSSEGMAAVGLDHLELIHRLKTAALV | |||
Physicochemical properties | |||
| Number of amino acids: | 236 | ||
| Molecular weight: | 11,627.056 | ||
| Theoretical pI: | 11.845 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 0 0 | ||
| Instability index: | 76.368 | ||
| aromaticity | 0.010 | ||
| GRAVY | -0.927 | ||
Secondary Structure Fraction | |||
| Helix | 0.250 | ||
| turn | 0.180 | ||
| sheet | 0.220 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY338240.1 | complete | 147 | 500-57(-) |
Amino Acid sequence : | |||
| MASPASTAAFSPNTLWLVGFPRRRSSLSMKGRSSCIRDMVWIISTAQAAGMAVDSSPPTSSQAVMQRIGRTLLPPARREYLMDSWISTGSFSWIAASNALFTEFSFSTMYFLISNCEEVD DSLVWVRIAETQKLARDERTDLYLRPP* | |||
Physicochemical properties | |||
| Number of amino acids: | 147 | ||
| Molecular weight: | 11,627.056 | ||
| Theoretical pI: | 11.845 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 0 0 | ||
| Instability index: | 76.368 | ||
| aromaticity | 0.010 | ||
| GRAVY | -0.927 | ||
Secondary Structure Fraction | |||
| Helix | 0.250 | ||
| turn | 0.180 | ||
| sheet | 0.220 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY338240.1 | 5prime_partial | 100 | 708-406(-) |
Amino Acid sequence : | |||
| HQRRRLQAVDQLQVIESHSRHPLRTDVHHLTPRQPLRPDQIRQLPHRPHHSLRRHAPRRGGHVFERERQHGVAGQHRRVLAEHLVVGGLPAAEVVVVHEG* | |||
Physicochemical properties | |||
| Number of amino acids: | 100 | ||
| Molecular weight: | 11,627.056 | ||
| Theoretical pI: | 11.845 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 0 0 | ||
| Instability index: | 76.368 | ||
| aromaticity | 0.010 | ||
| GRAVY | -0.927 | ||
Secondary Structure Fraction | |||
| Helix | 0.250 | ||
| turn | 0.180 | ||
| sheet | 0.220 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY338240.1 | internal | 236 | 1-708(+) |
Amino Acid sequence : | |||
| ARRFNPTTKLPHTICAIDVHGGRRYRSVLSSRANFCVSAILTQTKESSTSSQFDIKKYMVEKENSVNRALEAAIQLKEPVEIHESMRYSLLAGGKRVRPILCITACELVGGEESTAMPAA CAVEMIQTMSLMHDDLPFMDNDDLRRGKPTNHKVFGENAAVLAGDAMLSFAFEHVAAATRGVAPERVVRAVRELANLIGSEGLSGGQVVDVSSEGMAAVGLDHLELIHRLKTAALV | |||
Physicochemical properties | |||
| Number of amino acids: | 236 | ||
| Molecular weight: | 11,627.056 | ||
| Theoretical pI: | 11.845 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 0 0 | ||
| Instability index: | 76.368 | ||
| aromaticity | 0.010 | ||
| GRAVY | -0.927 | ||
Secondary Structure Fraction | |||
| Helix | 0.250 | ||
| turn | 0.180 | ||
| sheet | 0.220 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY338240.1 | complete | 147 | 500-57(-) |
Amino Acid sequence : | |||
| MASPASTAAFSPNTLWLVGFPRRRSSLSMKGRSSCIRDMVWIISTAQAAGMAVDSSPPTSSQAVMQRIGRTLLPPARREYLMDSWISTGSFSWIAASNALFTEFSFSTMYFLISNCEEVD DSLVWVRIAETQKLARDERTDLYLRPP* | |||
Physicochemical properties | |||
| Number of amino acids: | 147 | ||
| Molecular weight: | 11,627.056 | ||
| Theoretical pI: | 11.845 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 0 0 | ||
| Instability index: | 76.368 | ||
| aromaticity | 0.010 | ||
| GRAVY | -0.927 | ||
Secondary Structure Fraction | |||
| Helix | 0.250 | ||
| turn | 0.180 | ||
| sheet | 0.220 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY338240.1 | 5prime_partial | 100 | 708-406(-) |
Amino Acid sequence : | |||
| HQRRRLQAVDQLQVIESHSRHPLRTDVHHLTPRQPLRPDQIRQLPHRPHHSLRRHAPRRGGHVFERERQHGVAGQHRRVLAEHLVVGGLPAAEVVVVHEG* | |||
Physicochemical properties | |||
| Number of amino acids: | 100 | ||
| Molecular weight: | 11,627.056 | ||
| Theoretical pI: | 11.845 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 0 0 | ||
| Instability index: | 76.368 | ||
| aromaticity | 0.010 | ||
| GRAVY | -0.927 | ||
Secondary Structure Fraction | |||
| Helix | 0.250 | ||
| turn | 0.180 | ||
| sheet | 0.220 | ||