| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY338241.1 | 5prime_partial | 255 | 789-22(-) |
Amino Acid sequence : | |||
| GGKRVRPILCITACELVGGEESTAMPAACAVEMIQTMSLMHDDLPFMDNDDLRRGKPTNHKVFGENAAVLAGDAMLSFAFEHVAAATRGVAPERVVRAVRELANLIGSEGLSGGQVVDVS SEGMAAVGLDHLELIHRLKTAALVQASVVLGAVVGGASEEEIEKLRRFASCIGLLFQVVDDILDVTKSSAELGKTAGKDLAADKATYPKLIGLEKSRELADKLNREAKEQLLHFDPHRAA PLIALARLYCLQKKD* | |||
Physicochemical properties | |||
| Number of amino acids: | 255 | ||
| Molecular weight: | 15,125.812 | ||
| Theoretical pI: | 5.561 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 15470 15595 | ||
| Instability index: | 107.252 | ||
| aromaticity | 0.049 | ||
| GRAVY | -0.594 | ||
Secondary Structure Fraction | |||
| Helix | 0.203 | ||
| turn | 0.483 | ||
| sheet | 0.154 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY338241.1 | 5prime_partial | 161 | 787-302(-) |
Amino Acid sequence : | |||
| RQESAADPLHHGLRVGWRRGIHGHAGGLRRRDDPDHVPDARRPTLHGQRRPPPREAHQPQGVRRERGGAGRRRHAVVRVRTRGRRDEGRGAGESGEGGAGAGEFDRVGGAVGGSGGGRQF GGDGGCGTRSPGVDPPPEDGGAGAGVGGSGGGCGRSERGGN* | |||
Physicochemical properties | |||
| Number of amino acids: | 161 | ||
| Molecular weight: | 15,125.812 | ||
| Theoretical pI: | 5.561 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 15470 15595 | ||
| Instability index: | 107.252 | ||
| aromaticity | 0.049 | ||
| GRAVY | -0.594 | ||
Secondary Structure Fraction | |||
| Helix | 0.203 | ||
| turn | 0.483 | ||
| sheet | 0.154 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY338241.1 | 5prime_partial | 143 | 3-434(+) |
Amino Acid sequence : | |||
| EIIKYRVNPSSVSNIIGREQSRGQPCADQSEAAVPLPPDSICRPILWISPAQSALDTWLYPPPNPFRPSSPIPPTISSHPECHPPPETAALYSSQISSISQFPPRSLLPQPPPEPPTPAP APPSSGGGSTPGDRVPQPPSPPN* | |||
Physicochemical properties | |||
| Number of amino acids: | 143 | ||
| Molecular weight: | 15,125.812 | ||
| Theoretical pI: | 5.561 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 15470 15595 | ||
| Instability index: | 107.252 | ||
| aromaticity | 0.049 | ||
| GRAVY | -0.594 | ||
Secondary Structure Fraction | |||
| Helix | 0.203 | ||
| turn | 0.483 | ||
| sheet | 0.154 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY338241.1 | 5prime_partial | 255 | 789-22(-) |
Amino Acid sequence : | |||
| GGKRVRPILCITACELVGGEESTAMPAACAVEMIQTMSLMHDDLPFMDNDDLRRGKPTNHKVFGENAAVLAGDAMLSFAFEHVAAATRGVAPERVVRAVRELANLIGSEGLSGGQVVDVS SEGMAAVGLDHLELIHRLKTAALVQASVVLGAVVGGASEEEIEKLRRFASCIGLLFQVVDDILDVTKSSAELGKTAGKDLAADKATYPKLIGLEKSRELADKLNREAKEQLLHFDPHRAA PLIALARLYCLQKKD* | |||
Physicochemical properties | |||
| Number of amino acids: | 255 | ||
| Molecular weight: | 15,125.812 | ||
| Theoretical pI: | 5.561 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 15470 15595 | ||
| Instability index: | 107.252 | ||
| aromaticity | 0.049 | ||
| GRAVY | -0.594 | ||
Secondary Structure Fraction | |||
| Helix | 0.203 | ||
| turn | 0.483 | ||
| sheet | 0.154 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY338241.1 | 5prime_partial | 161 | 787-302(-) |
Amino Acid sequence : | |||
| RQESAADPLHHGLRVGWRRGIHGHAGGLRRRDDPDHVPDARRPTLHGQRRPPPREAHQPQGVRRERGGAGRRRHAVVRVRTRGRRDEGRGAGESGEGGAGAGEFDRVGGAVGGSGGGRQF GGDGGCGTRSPGVDPPPEDGGAGAGVGGSGGGCGRSERGGN* | |||
Physicochemical properties | |||
| Number of amino acids: | 161 | ||
| Molecular weight: | 15,125.812 | ||
| Theoretical pI: | 5.561 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 15470 15595 | ||
| Instability index: | 107.252 | ||
| aromaticity | 0.049 | ||
| GRAVY | -0.594 | ||
Secondary Structure Fraction | |||
| Helix | 0.203 | ||
| turn | 0.483 | ||
| sheet | 0.154 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY338241.1 | 5prime_partial | 143 | 3-434(+) |
Amino Acid sequence : | |||
| EIIKYRVNPSSVSNIIGREQSRGQPCADQSEAAVPLPPDSICRPILWISPAQSALDTWLYPPPNPFRPSSPIPPTISSHPECHPPPETAALYSSQISSISQFPPRSLLPQPPPEPPTPAP APPSSGGGSTPGDRVPQPPSPPN* | |||
Physicochemical properties | |||
| Number of amino acids: | 143 | ||
| Molecular weight: | 15,125.812 | ||
| Theoretical pI: | 5.561 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 15470 15595 | ||
| Instability index: | 107.252 | ||
| aromaticity | 0.049 | ||
| GRAVY | -0.594 | ||
Secondary Structure Fraction | |||
| Helix | 0.203 | ||
| turn | 0.483 | ||
| sheet | 0.154 | ||