| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY338255.1 | 3prime_partial | 175 | 98-622(+) |
Amino Acid sequence : | |||
| MLFLGGAGVRGMEMEGKFIKFTAIGVYLEDSSVAVLAAKWKGKTADELADSDEFVREVITGPFEKLTKVTTILPLTGQQYSEKVAENCTAYWKAVGKYTEAEGEAIAKFLQIFKDETFPP GASILFTQSASGSLTIAFSDDGSVPEQGKAVINNKLLAEAILESIIGRHGVSPTA | |||
Physicochemical properties | |||
| Number of amino acids: | 175 | ||
| Molecular weight: | 18,731.164 | ||
| Theoretical pI: | 4.902 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 16960 16960 | ||
| Instability index: | 28.622 | ||
| aromaticity | 0.091 | ||
| GRAVY | 0.045 | ||
Secondary Structure Fraction | |||
| Helix | 0.309 | ||
| turn | 0.217 | ||
| sheet | 0.303 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY338255.1 | 3prime_partial | 175 | 98-622(+) |
Amino Acid sequence : | |||
| MLFLGGAGVRGMEMEGKFIKFTAIGVYLEDSSVAVLAAKWKGKTADELADSDEFVREVITGPFEKLTKVTTILPLTGQQYSEKVAENCTAYWKAVGKYTEAEGEAIAKFLQIFKDETFPP GASILFTQSASGSLTIAFSDDGSVPEQGKAVINNKLLAEAILESIIGRHGVSPTA | |||
Physicochemical properties | |||
| Number of amino acids: | 175 | ||
| Molecular weight: | 18,731.164 | ||
| Theoretical pI: | 4.902 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 16960 16960 | ||
| Instability index: | 28.622 | ||
| aromaticity | 0.091 | ||
| GRAVY | 0.045 | ||
Secondary Structure Fraction | |||
| Helix | 0.309 | ||
| turn | 0.217 | ||
| sheet | 0.303 | ||