Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY338258.1 | internal | 123 | 369-1(-) |
Amino Acid sequence : | |||
HEELKSLERHAHSPSMILRLADDLGTSSDEMKRGDVPKAIQCFTNDMGCCEEEARQHVKRLIDAEWKKMNKDILMEKPFKNFGSTAMNLGRIAMSYYEHGDGYGCPHSDTNEENGVPLRX XHE | |||
Physicochemical properties | |||
Number of amino acids: | 123 | ||
Molecular weight: | 13,807.395 | ||
Theoretical pI: | 5.626 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 9970 10220 | ||
Instability index: | 42.515 | ||
aromaticity | 0.058 | ||
GRAVY | -0.876 | ||
Secondary Structure Fraction | |||
Helix | 0.198 | ||
turn | 0.231 | ||
sheet | 0.298 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY338258.1 | internal | 123 | 369-1(-) |
Amino Acid sequence : | |||
HEELKSLERHAHSPSMILRLADDLGTSSDEMKRGDVPKAIQCFTNDMGCCEEEARQHVKRLIDAEWKKMNKDILMEKPFKNFGSTAMNLGRIAMSYYEHGDGYGCPHSDTNEENGVPLRX XHE | |||
Physicochemical properties | |||
Number of amino acids: | 123 | ||
Molecular weight: | 13,807.395 | ||
Theoretical pI: | 5.626 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 9970 10220 | ||
Instability index: | 42.515 | ||
aromaticity | 0.058 | ||
GRAVY | -0.876 | ||
Secondary Structure Fraction | |||
Helix | 0.198 | ||
turn | 0.231 | ||
sheet | 0.298 |