| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY338263.1 | 5prime_partial | 194 | 778-194(-) |
Amino Acid sequence : | |||
| HMKAFTNAMIAHARLTAAAIVSNYPAAFDGLRSVVDVGGRHGTAIGRLVEAFPWVRGIAFDLPEIVADAPPRKGVDFVGGDMFESVPKADAVMLMWILHDWSDNKCIEILKKCKEAIPAS TGKVMIVDAIINEDGEGDEFSGARLSLDMTMLAVMAQGKERTYKEWVHLLNEAGFSKHTVKNIKSIESVIEAYP* | |||
Physicochemical properties | |||
| Number of amino acids: | 194 | ||
| Molecular weight: | 18,402.774 | ||
| Theoretical pI: | 11.852 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 12950 12950 | ||
| Instability index: | 89.255 | ||
| aromaticity | 0.118 | ||
| GRAVY | -0.748 | ||
Secondary Structure Fraction | |||
| Helix | 0.294 | ||
| turn | 0.222 | ||
| sheet | 0.137 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY338263.1 | complete | 153 | 275-736(+) |
Amino Acid sequence : | |||
| MHPFLISSLLSLRHHRQHCHIQRQTSTRKLVAFSIFVNYSIYNHHFSGTRWNRFFAFLQNFYAFIVAPVMQYPHEHDRVGFRHAFKHVPSDEVDPFTRRSIRHNLRQIKRNSPHPRKRLH QSPDSRSVAAAHIHHRSQSVKRRRIVAYNGSRR* | |||
Physicochemical properties | |||
| Number of amino acids: | 153 | ||
| Molecular weight: | 18,402.774 | ||
| Theoretical pI: | 11.852 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 12950 12950 | ||
| Instability index: | 89.255 | ||
| aromaticity | 0.118 | ||
| GRAVY | -0.748 | ||
Secondary Structure Fraction | |||
| Helix | 0.294 | ||
| turn | 0.222 | ||
| sheet | 0.137 | ||