| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY338265.1 | internal | 165 | 496-2(-) |
Amino Acid sequence : | |||
| HEASCRIRHEVPNGLSLSKDASFFVFCEGQIGRLSKYWLKGEKAGTWEPLAVLPGFPDNVRTNEKGELWVALHCRRSIYAHILGQYPKLRYAWLKLPISAKMHYLMQIGGRPRGLVVKYS PEGKLLEILEDRQGKVVKAVSEVEERDGKLWIGSVLMSFKAVSHX | |||
Physicochemical properties | |||
| Number of amino acids: | 165 | ||
| Molecular weight: | 18,630.500 | ||
| Theoretical pI: | 9.489 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 36440 36565 | ||
| Instability index: | 45.960 | ||
| aromaticity | 0.098 | ||
| GRAVY | -0.252 | ||
Secondary Structure Fraction | |||
| Helix | 0.341 | ||
| turn | 0.232 | ||
| sheet | 0.274 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY338265.1 | internal | 165 | 496-2(-) |
Amino Acid sequence : | |||
| HEASCRIRHEVPNGLSLSKDASFFVFCEGQIGRLSKYWLKGEKAGTWEPLAVLPGFPDNVRTNEKGELWVALHCRRSIYAHILGQYPKLRYAWLKLPISAKMHYLMQIGGRPRGLVVKYS PEGKLLEILEDRQGKVVKAVSEVEERDGKLWIGSVLMSFKAVSHX | |||
Physicochemical properties | |||
| Number of amino acids: | 165 | ||
| Molecular weight: | 18,630.500 | ||
| Theoretical pI: | 9.489 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 36440 36565 | ||
| Instability index: | 45.960 | ||
| aromaticity | 0.098 | ||
| GRAVY | -0.252 | ||
Secondary Structure Fraction | |||
| Helix | 0.341 | ||
| turn | 0.232 | ||
| sheet | 0.274 | ||