| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY338268.1 | internal | 238 | 2-715(+) |
Amino Acid sequence : | |||
| IVSNGLKLAASLSMAEHIPSLRWMFPLNEDAFAKHGARRDQLTLEIMEEHTRAREESGGAKQHFFDALLTLKDKYDLSEDTIIGLLWDMITAGMDTTAISVEWAMAELIKNPRVQQKAQE ELDRVIGYERVMTELDFSNLPYLQCVAKEALRLHPPTPLMLPHRSNSNVKIGGYDIPKGSNVHVNVWAVAHDPAVWKNPCEFRTERFLEEDVDMRGHDFRLLPFGAGRRVCPCAQLGI | |||
Physicochemical properties | |||
| Number of amino acids: | 238 | ||
| Molecular weight: | 11,148.925 | ||
| Theoretical pI: | 9.967 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 6990 7240 | ||
| Instability index: | 71.521 | ||
| aromaticity | 0.029 | ||
| GRAVY | 0.199 | ||
Secondary Structure Fraction | |||
| Helix | 0.248 | ||
| turn | 0.324 | ||
| sheet | 0.257 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY338268.1 | 3prime_partial | 105 | 315-1(-) |
Amino Acid sequence : | |||
| MAHSTDIAVVSIPAVIMSQRRPMMVSSLRSYLSLSVSKASKKCCLAPPLSSRARVCSSIISRVSWSRRAPCLAKASSLSGNIQRSDGICSAIDSEAASFSPLETM | |||
Physicochemical properties | |||
| Number of amino acids: | 105 | ||
| Molecular weight: | 11,148.925 | ||
| Theoretical pI: | 9.967 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 6990 7240 | ||
| Instability index: | 71.521 | ||
| aromaticity | 0.029 | ||
| GRAVY | 0.199 | ||
Secondary Structure Fraction | |||
| Helix | 0.248 | ||
| turn | 0.324 | ||
| sheet | 0.257 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY338268.1 | internal | 238 | 2-715(+) |
Amino Acid sequence : | |||
| IVSNGLKLAASLSMAEHIPSLRWMFPLNEDAFAKHGARRDQLTLEIMEEHTRAREESGGAKQHFFDALLTLKDKYDLSEDTIIGLLWDMITAGMDTTAISVEWAMAELIKNPRVQQKAQE ELDRVIGYERVMTELDFSNLPYLQCVAKEALRLHPPTPLMLPHRSNSNVKIGGYDIPKGSNVHVNVWAVAHDPAVWKNPCEFRTERFLEEDVDMRGHDFRLLPFGAGRRVCPCAQLGI | |||
Physicochemical properties | |||
| Number of amino acids: | 238 | ||
| Molecular weight: | 11,148.925 | ||
| Theoretical pI: | 9.967 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 6990 7240 | ||
| Instability index: | 71.521 | ||
| aromaticity | 0.029 | ||
| GRAVY | 0.199 | ||
Secondary Structure Fraction | |||
| Helix | 0.248 | ||
| turn | 0.324 | ||
| sheet | 0.257 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY338268.1 | 3prime_partial | 105 | 315-1(-) |
Amino Acid sequence : | |||
| MAHSTDIAVVSIPAVIMSQRRPMMVSSLRSYLSLSVSKASKKCCLAPPLSSRARVCSSIISRVSWSRRAPCLAKASSLSGNIQRSDGICSAIDSEAASFSPLETM | |||
Physicochemical properties | |||
| Number of amino acids: | 105 | ||
| Molecular weight: | 11,148.925 | ||
| Theoretical pI: | 9.967 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 6990 7240 | ||
| Instability index: | 71.521 | ||
| aromaticity | 0.029 | ||
| GRAVY | 0.199 | ||
Secondary Structure Fraction | |||
| Helix | 0.248 | ||
| turn | 0.324 | ||
| sheet | 0.257 | ||