Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY338283.1 | 3prime_partial | 156 | 69-536(+) |
Amino Acid sequence : | |||
MAPLTLMNQDKVLMESWYHLKDAVLDGGIPFNKAYGMTAFEYHGTDPRFNKVFNQGMSNHSTITMKKILETYTGFDGLKTVVDVGGGTGATLSMIVSKYPSIKGINFDLPHVIGDAPSYP GVEHVGGDMFASVPKGDAIFMKWICHDWSDEHCVKF | |||
Physicochemical properties | |||
Number of amino acids: | 156 | ||
Molecular weight: | 17,225.580 | ||
Theoretical pI: | 5.918 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 25440 25565 | ||
Instability index: | 21.451 | ||
aromaticity | 0.115 | ||
GRAVY | -0.120 | ||
Secondary Structure Fraction | |||
Helix | 0.308 | ||
turn | 0.256 | ||
sheet | 0.199 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY338283.1 | 3prime_partial | 156 | 69-536(+) |
Amino Acid sequence : | |||
MAPLTLMNQDKVLMESWYHLKDAVLDGGIPFNKAYGMTAFEYHGTDPRFNKVFNQGMSNHSTITMKKILETYTGFDGLKTVVDVGGGTGATLSMIVSKYPSIKGINFDLPHVIGDAPSYP GVEHVGGDMFASVPKGDAIFMKWICHDWSDEHCVKF | |||
Physicochemical properties | |||
Number of amino acids: | 156 | ||
Molecular weight: | 17,225.580 | ||
Theoretical pI: | 5.918 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 25440 25565 | ||
Instability index: | 21.451 | ||
aromaticity | 0.115 | ||
GRAVY | -0.120 | ||
Secondary Structure Fraction | |||
Helix | 0.308 | ||
turn | 0.256 | ||
sheet | 0.199 |