| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY338283.1 | 3prime_partial | 156 | 69-536(+) |
Amino Acid sequence : | |||
| MAPLTLMNQDKVLMESWYHLKDAVLDGGIPFNKAYGMTAFEYHGTDPRFNKVFNQGMSNHSTITMKKILETYTGFDGLKTVVDVGGGTGATLSMIVSKYPSIKGINFDLPHVIGDAPSYP GVEHVGGDMFASVPKGDAIFMKWICHDWSDEHCVKF | |||
Physicochemical properties | |||
| Number of amino acids: | 156 | ||
| Molecular weight: | 17,225.580 | ||
| Theoretical pI: | 5.918 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 25440 25565 | ||
| Instability index: | 21.451 | ||
| aromaticity | 0.115 | ||
| GRAVY | -0.120 | ||
Secondary Structure Fraction | |||
| Helix | 0.308 | ||
| turn | 0.256 | ||
| sheet | 0.199 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY338283.1 | 3prime_partial | 156 | 69-536(+) |
Amino Acid sequence : | |||
| MAPLTLMNQDKVLMESWYHLKDAVLDGGIPFNKAYGMTAFEYHGTDPRFNKVFNQGMSNHSTITMKKILETYTGFDGLKTVVDVGGGTGATLSMIVSKYPSIKGINFDLPHVIGDAPSYP GVEHVGGDMFASVPKGDAIFMKWICHDWSDEHCVKF | |||
Physicochemical properties | |||
| Number of amino acids: | 156 | ||
| Molecular weight: | 17,225.580 | ||
| Theoretical pI: | 5.918 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 25440 25565 | ||
| Instability index: | 21.451 | ||
| aromaticity | 0.115 | ||
| GRAVY | -0.120 | ||
Secondary Structure Fraction | |||
| Helix | 0.308 | ||
| turn | 0.256 | ||
| sheet | 0.199 | ||