| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY338289.1 | 5prime_partial | 167 | 3-506(+) |
Amino Acid sequence : | |||
| TPYKIYRIHDKLFIGLSGLATDAQTLYQKLVFRHKLYHLREERDMKPETFASLVSALLYEKRFGPFFCQPVIAGLGDDDKPFICTMDSIGAKELAKDFVVAGTASESLYGACESMFKPDM EAEELFETISQALLASVDRDCLSGWGGHVYLVTPTEVKERILKGRMD* | |||
Physicochemical properties | |||
| Number of amino acids: | 167 | ||
| Molecular weight: | 18,811.462 | ||
| Theoretical pI: | 5.414 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 15930 16180 | ||
| Instability index: | 28.401 | ||
| aromaticity | 0.108 | ||
| GRAVY | -0.123 | ||
Secondary Structure Fraction | |||
| Helix | 0.323 | ||
| turn | 0.174 | ||
| sheet | 0.299 | ||