Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY338289.1 | 5prime_partial | 167 | 3-506(+) |
Amino Acid sequence : | |||
TPYKIYRIHDKLFIGLSGLATDAQTLYQKLVFRHKLYHLREERDMKPETFASLVSALLYEKRFGPFFCQPVIAGLGDDDKPFICTMDSIGAKELAKDFVVAGTASESLYGACESMFKPDM EAEELFETISQALLASVDRDCLSGWGGHVYLVTPTEVKERILKGRMD* | |||
Physicochemical properties | |||
Number of amino acids: | 167 | ||
Molecular weight: | 18,811.462 | ||
Theoretical pI: | 5.414 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 15930 16180 | ||
Instability index: | 28.401 | ||
aromaticity | 0.108 | ||
GRAVY | -0.123 | ||
Secondary Structure Fraction | |||
Helix | 0.323 | ||
turn | 0.174 | ||
sheet | 0.299 |