Acc_NO	ORF type	length	start-end position (strand +/-)
>DY338298.1	internal	142	1-426(+)
Amino Acid sequence :
ATTKLPVPVIDMADAETLPEKLVAACEEFGCFRVKNHGIPSSLMSDMKAVARTLLDLPLESKMRNFDSNEPSKGYTPPNMASAFFDSLSLYDMASPAAVDHFCRQMDASPHQREIIGKYV SAMNDLVMVMGEKLVEGLGFGG
Physicochemical properties
Number of amino acids:		142
Molecular weight:		12,178.539
Theoretical pI:		9.961
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		8480 8480
Instability index:		70.341
aromaticity		0.075
GRAVY		-0.489
Secondary Structure Fraction
Helix		0.302
turn		0.198
sheet		0.255

Acc_NO	ORF type	length	start-end position (strand +/-)
>DY338298.1	internal	141	3-425(+)
Amino Acid sequence :
DHQTTCTSYRHGGRRNSAGKARRRLRRIRVLQSEEPRHSVVSHVRHEGRGSHSVGSPVGIEDAKLRLQRAFQGIHSAQHGERLLRQPQPLRHGVSGRRRSLLPSDGCFASSEGDNWEVCE CDERFGDGDGGKIGGGIRVWR
Physicochemical properties
Number of amino acids:		141
Molecular weight:		12,178.539
Theoretical pI:		9.961
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		8480 8480
Instability index:		70.341
aromaticity		0.075
GRAVY		-0.489
Secondary Structure Fraction
Helix		0.302
turn		0.198
sheet		0.255

Acc_NO	ORF type	length	start-end position (strand +/-)
>DY338298.1	complete	106	333-13(-)
Amino Acid sequence :
MRRSIHLTAEVIDGGRRRHVVEAEAVEEGARHVGRSVSLGRLVGVEVSHLRFQREIQQSASHGLHVGHERRRNAVVLHSEAPEFFAGGDELFRQSFCVRHVYNWYR*
Physicochemical properties
Number of amino acids:		106
Molecular weight:		12,178.539
Theoretical pI:		9.961
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		8480 8480
Instability index:		70.341
aromaticity		0.075
GRAVY		-0.489
Secondary Structure Fraction
Helix		0.302
turn		0.198
sheet		0.255

Acc_NO	ORF type	length	start-end position (strand +/-)
>DY338298.1	internal	142	1-426(+)
Amino Acid sequence :
ATTKLPVPVIDMADAETLPEKLVAACEEFGCFRVKNHGIPSSLMSDMKAVARTLLDLPLESKMRNFDSNEPSKGYTPPNMASAFFDSLSLYDMASPAAVDHFCRQMDASPHQREIIGKYV SAMNDLVMVMGEKLVEGLGFGG
Physicochemical properties
Number of amino acids:		142
Molecular weight:		12,178.539
Theoretical pI:		9.961
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		8480 8480
Instability index:		70.341
aromaticity		0.075
GRAVY		-0.489
Secondary Structure Fraction
Helix		0.302
turn		0.198
sheet		0.255

Acc_NO	ORF type	length	start-end position (strand +/-)
>DY338298.1	internal	141	3-425(+)
Amino Acid sequence :
DHQTTCTSYRHGGRRNSAGKARRRLRRIRVLQSEEPRHSVVSHVRHEGRGSHSVGSPVGIEDAKLRLQRAFQGIHSAQHGERLLRQPQPLRHGVSGRRRSLLPSDGCFASSEGDNWEVCE CDERFGDGDGGKIGGGIRVWR
Physicochemical properties
Number of amino acids:		141
Molecular weight:		12,178.539
Theoretical pI:		9.961
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		8480 8480
Instability index:		70.341
aromaticity		0.075
GRAVY		-0.489
Secondary Structure Fraction
Helix		0.302
turn		0.198
sheet		0.255

Acc_NO	ORF type	length	start-end position (strand +/-)
>DY338298.1	complete	106	333-13(-)
Amino Acid sequence :
MRRSIHLTAEVIDGGRRRHVVEAEAVEEGARHVGRSVSLGRLVGVEVSHLRFQREIQQSASHGLHVGHERRRNAVVLHSEAPEFFAGGDELFRQSFCVRHVYNWYR*
Physicochemical properties
Number of amino acids:		106
Molecular weight:		12,178.539
Theoretical pI:		9.961
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		8480 8480
Instability index:		70.341
aromaticity		0.075
GRAVY		-0.489
Secondary Structure Fraction
Helix		0.302
turn		0.198
sheet		0.255