| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY338305.1 | 3prime_partial | 172 | 261-776(+) |
Amino Acid sequence : | |||
| MGLNVIREAVDDTAGAAEYIAMNGLRDTAAIASARAAELYGLQILADGIQDDSGNVTRFVMLAREPIIPRIDRPFKTSIVFAHEKGTSVLFKVLSAFAFRNISLTKIESRPHRHRPIRLV DDANVGTAKHFEYMFYVDFEASMADVRAQNALADVQEFTSFLRVLGSYPMDM | |||
Physicochemical properties | |||
| Number of amino acids: | 172 | ||
| Molecular weight: | 14,394.835 | ||
| Theoretical pI: | 4.868 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 17990 18115 | ||
| Instability index: | 36.884 | ||
| aromaticity | 0.047 | ||
| GRAVY | -0.443 | ||
Secondary Structure Fraction | |||
| Helix | 0.299 | ||
| turn | 0.173 | ||
| sheet | 0.299 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY338305.1 | 5prime_partial | 127 | 776-393(-) |
Amino Acid sequence : | |||
| HVHRIASQHSQEGGELLHISQRVLCPDVGHGRFEIDVEHVLEMLRRADVGVVDEADWAVAVRPRLDLREADVAECEGGENLEQHASPLLVRENDARFERPIYPWNDWLTCEHHETRDVAG VVLDPVG* | |||
Physicochemical properties | |||
| Number of amino acids: | 127 | ||
| Molecular weight: | 14,394.835 | ||
| Theoretical pI: | 4.868 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 17990 18115 | ||
| Instability index: | 36.884 | ||
| aromaticity | 0.047 | ||
| GRAVY | -0.443 | ||
Secondary Structure Fraction | |||
| Helix | 0.299 | ||
| turn | 0.173 | ||
| sheet | 0.299 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY338305.1 | 3prime_partial | 172 | 261-776(+) |
Amino Acid sequence : | |||
| MGLNVIREAVDDTAGAAEYIAMNGLRDTAAIASARAAELYGLQILADGIQDDSGNVTRFVMLAREPIIPRIDRPFKTSIVFAHEKGTSVLFKVLSAFAFRNISLTKIESRPHRHRPIRLV DDANVGTAKHFEYMFYVDFEASMADVRAQNALADVQEFTSFLRVLGSYPMDM | |||
Physicochemical properties | |||
| Number of amino acids: | 172 | ||
| Molecular weight: | 14,394.835 | ||
| Theoretical pI: | 4.868 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 17990 18115 | ||
| Instability index: | 36.884 | ||
| aromaticity | 0.047 | ||
| GRAVY | -0.443 | ||
Secondary Structure Fraction | |||
| Helix | 0.299 | ||
| turn | 0.173 | ||
| sheet | 0.299 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY338305.1 | 5prime_partial | 127 | 776-393(-) |
Amino Acid sequence : | |||
| HVHRIASQHSQEGGELLHISQRVLCPDVGHGRFEIDVEHVLEMLRRADVGVVDEADWAVAVRPRLDLREADVAECEGGENLEQHASPLLVRENDARFERPIYPWNDWLTCEHHETRDVAG VVLDPVG* | |||
Physicochemical properties | |||
| Number of amino acids: | 127 | ||
| Molecular weight: | 14,394.835 | ||
| Theoretical pI: | 4.868 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 17990 18115 | ||
| Instability index: | 36.884 | ||
| aromaticity | 0.047 | ||
| GRAVY | -0.443 | ||
Secondary Structure Fraction | |||
| Helix | 0.299 | ||
| turn | 0.173 | ||
| sheet | 0.299 | ||