| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY338307.1 | 5prime_partial | 218 | 746-90(-) |
Amino Acid sequence : | |||
| SGGAFRDLPVEKLKDVKVADALKHPNWNMGKKITVDSATLFNKGLEVIEAHYLFGAEYDDIEIVIHPQSIIHSMVETQDSSVLAQLGWPDMRLPILYTMSWPDRVYCSEVTWPRLDLCKV SLTFKTPDNVKYPSMDLAYAAGRAGGTMTGVLSAANEKAVEMFINEQIGYLDIFKVVEMTCDKHRSELVTSPSLEEIVHYDLWARHYAANFNLTPAFV* | |||
Physicochemical properties | |||
| Number of amino acids: | 218 | ||
| Molecular weight: | 24,544.865 | ||
| Theoretical pI: | 5.214 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 40910 41035 | ||
| Instability index: | 40.682 | ||
| aromaticity | 0.101 | ||
| GRAVY | -0.085 | ||
Secondary Structure Fraction | |||
| Helix | 0.335 | ||
| turn | 0.202 | ||
| sheet | 0.275 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY338307.1 | 5prime_partial | 218 | 746-90(-) |
Amino Acid sequence : | |||
| SGGAFRDLPVEKLKDVKVADALKHPNWNMGKKITVDSATLFNKGLEVIEAHYLFGAEYDDIEIVIHPQSIIHSMVETQDSSVLAQLGWPDMRLPILYTMSWPDRVYCSEVTWPRLDLCKV SLTFKTPDNVKYPSMDLAYAAGRAGGTMTGVLSAANEKAVEMFINEQIGYLDIFKVVEMTCDKHRSELVTSPSLEEIVHYDLWARHYAANFNLTPAFV* | |||
Physicochemical properties | |||
| Number of amino acids: | 218 | ||
| Molecular weight: | 24,544.865 | ||
| Theoretical pI: | 5.214 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 40910 41035 | ||
| Instability index: | 40.682 | ||
| aromaticity | 0.101 | ||
| GRAVY | -0.085 | ||
Secondary Structure Fraction | |||
| Helix | 0.335 | ||
| turn | 0.202 | ||
| sheet | 0.275 | ||