| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY338308.1 | 3prime_partial | 246 | 23-760(+) |
Amino Acid sequence : | |||
| MANNTNAGVITCKAAVAWKPSEPLVVEEICVEPPKSTEVRIKMLAASMCHTDILLWKGFPLPLYPRIPGHEGAGVIESVGEKVTNLKVGDTVMPLSIGECGECSNCATGKTNICFKYPPG IAGLMPDGTSRMSAKGQKLYHMFSCSTWSEYTVVDSNFVVKVDPRIPLPHASLLTCGFMTGYGAPWRESRVEKGSTVAVIGLGAVGLGAVSASRILGASKIIGIDVNELKRDKARVFGVT EFINPK | |||
Physicochemical properties | |||
| Number of amino acids: | 246 | ||
| Molecular weight: | 12,856.748 | ||
| Theoretical pI: | 8.032 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 8480 8480 | ||
| Instability index: | 46.091 | ||
| aromaticity | 0.100 | ||
| GRAVY | 0.421 | ||
Secondary Structure Fraction | |||
| Helix | 0.325 | ||
| turn | 0.292 | ||
| sheet | 0.217 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY338308.1 | 3prime_partial | 120 | 360-1(-) |
Amino Acid sequence : | |||
| MFVFPVAQFEHSPHSPMESGITVSPTLRFVTFSPTLSITPAPSCPGIRGYRGRGKPFQSRISVWHMLAASILILTSVDLGGSTQISSTTSGSDGFHATAALHVMTPAFVLFAMVDILYLT | |||
Physicochemical properties | |||
| Number of amino acids: | 120 | ||
| Molecular weight: | 12,856.748 | ||
| Theoretical pI: | 8.032 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 8480 8480 | ||
| Instability index: | 46.091 | ||
| aromaticity | 0.100 | ||
| GRAVY | 0.421 | ||
Secondary Structure Fraction | |||
| Helix | 0.325 | ||
| turn | 0.292 | ||
| sheet | 0.217 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY338308.1 | 3prime_partial | 246 | 23-760(+) |
Amino Acid sequence : | |||
| MANNTNAGVITCKAAVAWKPSEPLVVEEICVEPPKSTEVRIKMLAASMCHTDILLWKGFPLPLYPRIPGHEGAGVIESVGEKVTNLKVGDTVMPLSIGECGECSNCATGKTNICFKYPPG IAGLMPDGTSRMSAKGQKLYHMFSCSTWSEYTVVDSNFVVKVDPRIPLPHASLLTCGFMTGYGAPWRESRVEKGSTVAVIGLGAVGLGAVSASRILGASKIIGIDVNELKRDKARVFGVT EFINPK | |||
Physicochemical properties | |||
| Number of amino acids: | 246 | ||
| Molecular weight: | 12,856.748 | ||
| Theoretical pI: | 8.032 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 8480 8480 | ||
| Instability index: | 46.091 | ||
| aromaticity | 0.100 | ||
| GRAVY | 0.421 | ||
Secondary Structure Fraction | |||
| Helix | 0.325 | ||
| turn | 0.292 | ||
| sheet | 0.217 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY338308.1 | 3prime_partial | 120 | 360-1(-) |
Amino Acid sequence : | |||
| MFVFPVAQFEHSPHSPMESGITVSPTLRFVTFSPTLSITPAPSCPGIRGYRGRGKPFQSRISVWHMLAASILILTSVDLGGSTQISSTTSGSDGFHATAALHVMTPAFVLFAMVDILYLT | |||
Physicochemical properties | |||
| Number of amino acids: | 120 | ||
| Molecular weight: | 12,856.748 | ||
| Theoretical pI: | 8.032 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 8480 8480 | ||
| Instability index: | 46.091 | ||
| aromaticity | 0.100 | ||
| GRAVY | 0.421 | ||
Secondary Structure Fraction | |||
| Helix | 0.325 | ||
| turn | 0.292 | ||
| sheet | 0.217 | ||