Acc_NO	ORF type	length	start-end position (strand +/-)
>DY338309.1	complete	165	44-541(+)
Amino Acid sequence :
MFDQCLPHFFHISIFLSIEATTMASSRSASAAARLSRSVAAAFRASRSGHHVPHTSSLAGQSTRSDLAAAIVRPRALTSPNGNHISSSILFSASGLNRVAARPYSSAQIPGTKAIRSVFW HINEGVEEVLADYVHHEMTRTWISICLRLFLIIMTKDVVVAVANL*
Physicochemical properties
Number of amino acids:		165
Molecular weight:		17,898.325
Theoretical pI:		10.363
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		13980 14105
Instability index:		56.413
aromaticity		0.073
GRAVY		0.232
Secondary Structure Fraction
Helix		0.303
turn		0.248
sheet		0.273