| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY338331.1 | internal | 261 | 1-783(+) |
Amino Acid sequence : | |||
| ARRFDPTTGKQMKAKTSTKSYTQYFAESLVAEAEQDDKVVAIHAAMGGGTGLNIFQKRFPDRCFDVGIAEQHAVTFAAGLATEGLKPFCTIYSSFLQRGYDQVVHDVDLQKLPVRFMMDR AGLVGADGPTHCGAFDTTYMACLPNMVVMAPSDEAELMHMVATAAVIDDRPSCVRYPRGNGVGAALPLNNKGVPLEVGKGRILKEGSRVAILGFGTIVQNCLAAANLLQEHGISVSVADA RFCKPLDGDLIKNLVKDHEIL | |||
Physicochemical properties | |||
| Number of amino acids: | 261 | ||
| Molecular weight: | 14,462.369 | ||
| Theoretical pI: | 5.459 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 12490 12865 | ||
| Instability index: | 49.924 | ||
| aromaticity | 0.069 | ||
| GRAVY | 0.003 | ||
Secondary Structure Fraction | |||
| Helix | 0.313 | ||
| turn | 0.221 | ||
| sheet | 0.282 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY338331.1 | 3prime_partial | 131 | 393-1(-) |
Amino Acid sequence : | |||
| MCGPIRPHQSSSIHHEPHRKLLEVHVMHHLIVPSLQERRVDRAEWLQPFCGEACSEGDSVLLGDPHVEATVREALLEDVETGSAAHGRVDSDYFVVLLRFGDEGLGEVLCVGFCAGFGLH LFPGCWIKPAC | |||
Physicochemical properties | |||
| Number of amino acids: | 131 | ||
| Molecular weight: | 14,462.369 | ||
| Theoretical pI: | 5.459 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 12490 12865 | ||
| Instability index: | 49.924 | ||
| aromaticity | 0.069 | ||
| GRAVY | 0.003 | ||
Secondary Structure Fraction | |||
| Helix | 0.313 | ||
| turn | 0.221 | ||
| sheet | 0.282 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY338331.1 | internal | 261 | 1-783(+) |
Amino Acid sequence : | |||
| ARRFDPTTGKQMKAKTSTKSYTQYFAESLVAEAEQDDKVVAIHAAMGGGTGLNIFQKRFPDRCFDVGIAEQHAVTFAAGLATEGLKPFCTIYSSFLQRGYDQVVHDVDLQKLPVRFMMDR AGLVGADGPTHCGAFDTTYMACLPNMVVMAPSDEAELMHMVATAAVIDDRPSCVRYPRGNGVGAALPLNNKGVPLEVGKGRILKEGSRVAILGFGTIVQNCLAAANLLQEHGISVSVADA RFCKPLDGDLIKNLVKDHEIL | |||
Physicochemical properties | |||
| Number of amino acids: | 261 | ||
| Molecular weight: | 14,462.369 | ||
| Theoretical pI: | 5.459 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 12490 12865 | ||
| Instability index: | 49.924 | ||
| aromaticity | 0.069 | ||
| GRAVY | 0.003 | ||
Secondary Structure Fraction | |||
| Helix | 0.313 | ||
| turn | 0.221 | ||
| sheet | 0.282 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY338331.1 | 3prime_partial | 131 | 393-1(-) |
Amino Acid sequence : | |||
| MCGPIRPHQSSSIHHEPHRKLLEVHVMHHLIVPSLQERRVDRAEWLQPFCGEACSEGDSVLLGDPHVEATVREALLEDVETGSAAHGRVDSDYFVVLLRFGDEGLGEVLCVGFCAGFGLH LFPGCWIKPAC | |||
Physicochemical properties | |||
| Number of amino acids: | 131 | ||
| Molecular weight: | 14,462.369 | ||
| Theoretical pI: | 5.459 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 12490 12865 | ||
| Instability index: | 49.924 | ||
| aromaticity | 0.069 | ||
| GRAVY | 0.003 | ||
Secondary Structure Fraction | |||
| Helix | 0.313 | ||
| turn | 0.221 | ||
| sheet | 0.282 | ||