| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY338333.1 | internal | 99 | 2-298(+) |
Amino Acid sequence : | |||
| IPHILHKHDHPMTVSQLLKAIPINKEKSQSFQRSMRDLINSNFFIEQNSNNQEVCYWLTPATRLLLKGAPLSVAPLAQVVMDPTFTNPWDYMSEWIKHE | |||
Physicochemical properties | |||
| Number of amino acids: | 99 | ||
| Molecular weight: | 11,527.148 | ||
| Theoretical pI: | 7.150 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 19480 19480 | ||
| Instability index: | 46.633 | ||
| aromaticity | 0.091 | ||
| GRAVY | -0.379 | ||
Secondary Structure Fraction | |||
| Helix | 0.313 | ||
| turn | 0.242 | ||
| sheet | 0.242 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY338333.1 | internal | 99 | 2-298(+) |
Amino Acid sequence : | |||
| IPHILHKHDHPMTVSQLLKAIPINKEKSQSFQRSMRDLINSNFFIEQNSNNQEVCYWLTPATRLLLKGAPLSVAPLAQVVMDPTFTNPWDYMSEWIKHE | |||
Physicochemical properties | |||
| Number of amino acids: | 99 | ||
| Molecular weight: | 11,527.148 | ||
| Theoretical pI: | 7.150 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 19480 19480 | ||
| Instability index: | 46.633 | ||
| aromaticity | 0.091 | ||
| GRAVY | -0.379 | ||
Secondary Structure Fraction | |||
| Helix | 0.313 | ||
| turn | 0.242 | ||
| sheet | 0.242 | ||