| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY338346.1 | complete | 149 | 67-516(+) |
Amino Acid sequence : | |||
| MAVQLTDDQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTIDFPEFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDE EVDEMIREADVDGDGQINYEEFVKVMMAK* | |||
Physicochemical properties | |||
| Number of amino acids: | 149 | ||
| Molecular weight: | 12,737.780 | ||
| Theoretical pI: | 5.746 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 8480 8730 | ||
| Instability index: | 56.773 | ||
| aromaticity | 0.063 | ||
| GRAVY | 0.383 | ||
Secondary Structure Fraction | |||
| Helix | 0.423 | ||
| turn | 0.144 | ||
| sheet | 0.333 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY338346.1 | complete | 111 | 390-55(-) |
Amino Acid sequence : | |||
| MAEFSCRYESILVLVKDSKSFLELLLRISVLHLACHEVEELWEVYCPIAISIHLVDHILKLSLRRVLSQRTHHSSQLLCGDATVTILVEKREGFLEFGDLIVGELDRHILS* | |||
Physicochemical properties | |||
| Number of amino acids: | 111 | ||
| Molecular weight: | 12,737.780 | ||
| Theoretical pI: | 5.746 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 8480 8730 | ||
| Instability index: | 56.773 | ||
| aromaticity | 0.063 | ||
| GRAVY | 0.383 | ||
Secondary Structure Fraction | |||
| Helix | 0.423 | ||
| turn | 0.144 | ||
| sheet | 0.333 | ||