Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY338346.1 | complete | 149 | 67-516(+) |
Amino Acid sequence : | |||
MAVQLTDDQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTIDFPEFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDE EVDEMIREADVDGDGQINYEEFVKVMMAK* | |||
Physicochemical properties | |||
Number of amino acids: | 149 | ||
Molecular weight: | 12,737.780 | ||
Theoretical pI: | 5.746 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 8480 8730 | ||
Instability index: | 56.773 | ||
aromaticity | 0.063 | ||
GRAVY | 0.383 | ||
Secondary Structure Fraction | |||
Helix | 0.423 | ||
turn | 0.144 | ||
sheet | 0.333 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY338346.1 | complete | 111 | 390-55(-) |
Amino Acid sequence : | |||
MAEFSCRYESILVLVKDSKSFLELLLRISVLHLACHEVEELWEVYCPIAISIHLVDHILKLSLRRVLSQRTHHSSQLLCGDATVTILVEKREGFLEFGDLIVGELDRHILS* | |||
Physicochemical properties | |||
Number of amino acids: | 111 | ||
Molecular weight: | 12,737.780 | ||
Theoretical pI: | 5.746 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 8480 8730 | ||
Instability index: | 56.773 | ||
aromaticity | 0.063 | ||
GRAVY | 0.383 | ||
Secondary Structure Fraction | |||
Helix | 0.423 | ||
turn | 0.144 | ||
sheet | 0.333 |