Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY338348.1 | complete | 192 | 65-643(+) |
Amino Acid sequence : | |||
MVFRDAMACHARLTTSAVIENYGEGFRGVGSLVDVGGSYGMTLGMLVEAFPWIRGICYDLPQVVAKAKPLHGVEFVAGSMFESVPEADVVMLMFVLHNWSDNECIDILKRCKEAIPRETG KVMIIDAIIEEDGEGDEFAEARLGLDVTMMAVTFEGKERTHREWAFILKEAGFRKYVVKNIKALESLIEAYP* | |||
Physicochemical properties | |||
Number of amino acids: | 192 | ||
Molecular weight: | 21,386.590 | ||
Theoretical pI: | 4.917 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 23950 24200 | ||
Instability index: | 30.727 | ||
aromaticity | 0.094 | ||
GRAVY | 0.133 | ||
Secondary Structure Fraction | |||
Helix | 0.333 | ||
turn | 0.177 | ||
sheet | 0.323 |