| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY338358.1 | 5prime_partial | 121 | 3-368(+) |
Amino Acid sequence : | |||
| ATIDNDLFIGVAMTLAKLGEKVTVQATFYSLYLGPIDQLLPTMQRAFPELGLGPELCTEMRWIDSFVDFGRFTSALPLPLTKPEDLLMRKDPDLLFVKRKGDLVHDPIPESGLDGLMELL Y* | |||
Physicochemical properties | |||
| Number of amino acids: | 121 | ||
| Molecular weight: | 13,556.698 | ||
| Theoretical pI: | 4.527 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 9970 9970 | ||
| Instability index: | 33.108 | ||
| aromaticity | 0.091 | ||
| GRAVY | 0.119 | ||
Secondary Structure Fraction | |||
| Helix | 0.364 | ||
| turn | 0.198 | ||
| sheet | 0.331 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY338358.1 | 5prime_partial | 121 | 3-368(+) |
Amino Acid sequence : | |||
| ATIDNDLFIGVAMTLAKLGEKVTVQATFYSLYLGPIDQLLPTMQRAFPELGLGPELCTEMRWIDSFVDFGRFTSALPLPLTKPEDLLMRKDPDLLFVKRKGDLVHDPIPESGLDGLMELL Y* | |||
Physicochemical properties | |||
| Number of amino acids: | 121 | ||
| Molecular weight: | 13,556.698 | ||
| Theoretical pI: | 4.527 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 9970 9970 | ||
| Instability index: | 33.108 | ||
| aromaticity | 0.091 | ||
| GRAVY | 0.119 | ||
Secondary Structure Fraction | |||
| Helix | 0.364 | ||
| turn | 0.198 | ||
| sheet | 0.331 | ||