| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY338378.1 | internal | 242 | 2-727(+) |
Amino Acid sequence : | |||
| AWPLYWICQGCILTGVWVIAHECGHHAFSDYQWLDDTVGLILHSFLLVPFFSWKYSHRRHHSNTGSLERDEVFVPKKKSELSWSAKYLNNPPGRVFSLVVQLTLGWPMYLMLNVSGRPYD RFACHFDPHSPIYSERERAQIVISDLGILAVTYGLYRLALAKGLAWVLCIYGAPLLVVNGFLVLITYLQHTHPSLPHYDSSEWDWLRGALATVDRDYGILNTIFHNITDTHVAHHLFSTM PH | |||
Physicochemical properties | |||
| Number of amino acids: | 242 | ||
| Molecular weight: | 27,842.682 | ||
| Theoretical pI: | 6.821 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 74370 74620 | ||
| Instability index: | 33.516 | ||
| aromaticity | 0.140 | ||
| GRAVY | 0.077 | ||
Secondary Structure Fraction | |||
| Helix | 0.401 | ||
| turn | 0.219 | ||
| sheet | 0.231 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY338378.1 | internal | 242 | 2-727(+) |
Amino Acid sequence : | |||
| AWPLYWICQGCILTGVWVIAHECGHHAFSDYQWLDDTVGLILHSFLLVPFFSWKYSHRRHHSNTGSLERDEVFVPKKKSELSWSAKYLNNPPGRVFSLVVQLTLGWPMYLMLNVSGRPYD RFACHFDPHSPIYSERERAQIVISDLGILAVTYGLYRLALAKGLAWVLCIYGAPLLVVNGFLVLITYLQHTHPSLPHYDSSEWDWLRGALATVDRDYGILNTIFHNITDTHVAHHLFSTM PH | |||
Physicochemical properties | |||
| Number of amino acids: | 242 | ||
| Molecular weight: | 27,842.682 | ||
| Theoretical pI: | 6.821 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 74370 74620 | ||
| Instability index: | 33.516 | ||
| aromaticity | 0.140 | ||
| GRAVY | 0.077 | ||
Secondary Structure Fraction | |||
| Helix | 0.401 | ||
| turn | 0.219 | ||
| sheet | 0.231 | ||