| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY338386.1 | internal | 269 | 2-808(+) |
Amino Acid sequence : | |||
| HPSTMEKAVERQRILLHHLRPSFTSSSLEDIESSVSASICSAGDSAAYHRFSVFGDDVVIVAAYRTPLCKSKRGGFKDTYPDDLLAPVLRAVIEKSNVNPSEVGDIVVGTVLAPGSQRAS ECRMAAFYAGFPDTVPVRTVNRQCSSGLQAVADVAAAIKAGFYDIGIGAGLESMTTNPMAWEGSVNPRVKTMAQAQNCLLPMGITSENVAHRFGVTRQEQDQAAVESHRKAAAATASGKF KDEIIPVKTKIVDPKSGDEKPVTISVDDG | |||
Physicochemical properties | |||
| Number of amino acids: | 269 | ||
| Molecular weight: | 28,651.098 | ||
| Theoretical pI: | 6.343 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 12950 13200 | ||
| Instability index: | 37.884 | ||
| aromaticity | 0.056 | ||
| GRAVY | -0.162 | ||
Secondary Structure Fraction | |||
| Helix | 0.257 | ||
| turn | 0.249 | ||
| sheet | 0.242 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY338386.1 | internal | 269 | 2-808(+) |
Amino Acid sequence : | |||
| HPSTMEKAVERQRILLHHLRPSFTSSSLEDIESSVSASICSAGDSAAYHRFSVFGDDVVIVAAYRTPLCKSKRGGFKDTYPDDLLAPVLRAVIEKSNVNPSEVGDIVVGTVLAPGSQRAS ECRMAAFYAGFPDTVPVRTVNRQCSSGLQAVADVAAAIKAGFYDIGIGAGLESMTTNPMAWEGSVNPRVKTMAQAQNCLLPMGITSENVAHRFGVTRQEQDQAAVESHRKAAAATASGKF KDEIIPVKTKIVDPKSGDEKPVTISVDDG | |||
Physicochemical properties | |||
| Number of amino acids: | 269 | ||
| Molecular weight: | 28,651.098 | ||
| Theoretical pI: | 6.343 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 12950 13200 | ||
| Instability index: | 37.884 | ||
| aromaticity | 0.056 | ||
| GRAVY | -0.162 | ||
Secondary Structure Fraction | |||
| Helix | 0.257 | ||
| turn | 0.249 | ||
| sheet | 0.242 | ||