| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY338395.1 | internal | 175 | 526-2(-) |
Amino Acid sequence : | |||
| EKTRAMKSIKDDKSHNCIRSKTVANRPNLSSEHDGTASLLNFLLSILRHQLRLHYDWLIGGKQSLPQHLEVSKLRDIDERRVVLGRLVLHLLRDERPEAVDVDGWAEELVAELVEVAHTD LAEVTRMVLVEEDAVVVHTTSVSATTGMLAVLADTTMAGAHVAALLAVLLESGCH | |||
Physicochemical properties | |||
| Number of amino acids: | 175 | ||
| Molecular weight: | 13,654.226 | ||
| Theoretical pI: | 11.673 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 37470 37470 | ||
| Instability index: | 89.991 | ||
| aromaticity | 0.077 | ||
| GRAVY | -1.244 | ||
Secondary Structure Fraction | |||
| Helix | 0.214 | ||
| turn | 0.274 | ||
| sheet | 0.231 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY338395.1 | complete | 146 | 2-442(+) |
Amino Acid sequence : | |||
| MTTRFKKNRKKRGHVSAGHGRIGKHRKHPGGRGNAGGMHHHRILFDKYHPGYFGKVGMRYFHKLRNKFFCPTVNIDRLWALVPQEVKDKATKDNAPLIDVTQFGYFKVLGKGLLPADKPV VVKAKLVSKNAEKKIKEAGGAVVLTA* | |||
Physicochemical properties | |||
| Number of amino acids: | 146 | ||
| Molecular weight: | 13,654.226 | ||
| Theoretical pI: | 11.673 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 37470 37470 | ||
| Instability index: | 89.991 | ||
| aromaticity | 0.077 | ||
| GRAVY | -1.244 | ||
Secondary Structure Fraction | |||
| Helix | 0.214 | ||
| turn | 0.274 | ||
| sheet | 0.231 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY338395.1 | 5prime_partial | 117 | 1-354(+) |
Amino Acid sequence : | |||
| NDNQIQEEPQEARPRERRPWSYRQAPQASRWSRKRWWYAPPPHPLRQVPSWLLRQGRYALLPQAPQQVLLPNRQHRPPLGARPARGEGQGDQGQRAAHRCHAVWILQGVGEGIASRR* | |||
Physicochemical properties | |||
| Number of amino acids: | 117 | ||
| Molecular weight: | 13,654.226 | ||
| Theoretical pI: | 11.673 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 37470 37470 | ||
| Instability index: | 89.991 | ||
| aromaticity | 0.077 | ||
| GRAVY | -1.244 | ||
Secondary Structure Fraction | |||
| Helix | 0.214 | ||
| turn | 0.274 | ||
| sheet | 0.231 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY338395.1 | internal | 175 | 526-2(-) |
Amino Acid sequence : | |||
| EKTRAMKSIKDDKSHNCIRSKTVANRPNLSSEHDGTASLLNFLLSILRHQLRLHYDWLIGGKQSLPQHLEVSKLRDIDERRVVLGRLVLHLLRDERPEAVDVDGWAEELVAELVEVAHTD LAEVTRMVLVEEDAVVVHTTSVSATTGMLAVLADTTMAGAHVAALLAVLLESGCH | |||
Physicochemical properties | |||
| Number of amino acids: | 175 | ||
| Molecular weight: | 13,654.226 | ||
| Theoretical pI: | 11.673 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 37470 37470 | ||
| Instability index: | 89.991 | ||
| aromaticity | 0.077 | ||
| GRAVY | -1.244 | ||
Secondary Structure Fraction | |||
| Helix | 0.214 | ||
| turn | 0.274 | ||
| sheet | 0.231 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY338395.1 | complete | 146 | 2-442(+) |
Amino Acid sequence : | |||
| MTTRFKKNRKKRGHVSAGHGRIGKHRKHPGGRGNAGGMHHHRILFDKYHPGYFGKVGMRYFHKLRNKFFCPTVNIDRLWALVPQEVKDKATKDNAPLIDVTQFGYFKVLGKGLLPADKPV VVKAKLVSKNAEKKIKEAGGAVVLTA* | |||
Physicochemical properties | |||
| Number of amino acids: | 146 | ||
| Molecular weight: | 13,654.226 | ||
| Theoretical pI: | 11.673 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 37470 37470 | ||
| Instability index: | 89.991 | ||
| aromaticity | 0.077 | ||
| GRAVY | -1.244 | ||
Secondary Structure Fraction | |||
| Helix | 0.214 | ||
| turn | 0.274 | ||
| sheet | 0.231 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY338395.1 | 5prime_partial | 117 | 1-354(+) |
Amino Acid sequence : | |||
| NDNQIQEEPQEARPRERRPWSYRQAPQASRWSRKRWWYAPPPHPLRQVPSWLLRQGRYALLPQAPQQVLLPNRQHRPPLGARPARGEGQGDQGQRAAHRCHAVWILQGVGEGIASRR* | |||
Physicochemical properties | |||
| Number of amino acids: | 117 | ||
| Molecular weight: | 13,654.226 | ||
| Theoretical pI: | 11.673 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 37470 37470 | ||
| Instability index: | 89.991 | ||
| aromaticity | 0.077 | ||
| GRAVY | -1.244 | ||
Secondary Structure Fraction | |||
| Helix | 0.214 | ||
| turn | 0.274 | ||
| sheet | 0.231 | ||