Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY338395.1 | internal | 175 | 526-2(-) |
Amino Acid sequence : | |||
EKTRAMKSIKDDKSHNCIRSKTVANRPNLSSEHDGTASLLNFLLSILRHQLRLHYDWLIGGKQSLPQHLEVSKLRDIDERRVVLGRLVLHLLRDERPEAVDVDGWAEELVAELVEVAHTD LAEVTRMVLVEEDAVVVHTTSVSATTGMLAVLADTTMAGAHVAALLAVLLESGCH | |||
Physicochemical properties | |||
Number of amino acids: | 175 | ||
Molecular weight: | 13,654.226 | ||
Theoretical pI: | 11.673 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 37470 37470 | ||
Instability index: | 89.991 | ||
aromaticity | 0.077 | ||
GRAVY | -1.244 | ||
Secondary Structure Fraction | |||
Helix | 0.214 | ||
turn | 0.274 | ||
sheet | 0.231 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY338395.1 | complete | 146 | 2-442(+) |
Amino Acid sequence : | |||
MTTRFKKNRKKRGHVSAGHGRIGKHRKHPGGRGNAGGMHHHRILFDKYHPGYFGKVGMRYFHKLRNKFFCPTVNIDRLWALVPQEVKDKATKDNAPLIDVTQFGYFKVLGKGLLPADKPV VVKAKLVSKNAEKKIKEAGGAVVLTA* | |||
Physicochemical properties | |||
Number of amino acids: | 146 | ||
Molecular weight: | 13,654.226 | ||
Theoretical pI: | 11.673 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 37470 37470 | ||
Instability index: | 89.991 | ||
aromaticity | 0.077 | ||
GRAVY | -1.244 | ||
Secondary Structure Fraction | |||
Helix | 0.214 | ||
turn | 0.274 | ||
sheet | 0.231 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY338395.1 | 5prime_partial | 117 | 1-354(+) |
Amino Acid sequence : | |||
NDNQIQEEPQEARPRERRPWSYRQAPQASRWSRKRWWYAPPPHPLRQVPSWLLRQGRYALLPQAPQQVLLPNRQHRPPLGARPARGEGQGDQGQRAAHRCHAVWILQGVGEGIASRR* | |||
Physicochemical properties | |||
Number of amino acids: | 117 | ||
Molecular weight: | 13,654.226 | ||
Theoretical pI: | 11.673 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 37470 37470 | ||
Instability index: | 89.991 | ||
aromaticity | 0.077 | ||
GRAVY | -1.244 | ||
Secondary Structure Fraction | |||
Helix | 0.214 | ||
turn | 0.274 | ||
sheet | 0.231 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY338395.1 | internal | 175 | 526-2(-) |
Amino Acid sequence : | |||
EKTRAMKSIKDDKSHNCIRSKTVANRPNLSSEHDGTASLLNFLLSILRHQLRLHYDWLIGGKQSLPQHLEVSKLRDIDERRVVLGRLVLHLLRDERPEAVDVDGWAEELVAELVEVAHTD LAEVTRMVLVEEDAVVVHTTSVSATTGMLAVLADTTMAGAHVAALLAVLLESGCH | |||
Physicochemical properties | |||
Number of amino acids: | 175 | ||
Molecular weight: | 13,654.226 | ||
Theoretical pI: | 11.673 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 37470 37470 | ||
Instability index: | 89.991 | ||
aromaticity | 0.077 | ||
GRAVY | -1.244 | ||
Secondary Structure Fraction | |||
Helix | 0.214 | ||
turn | 0.274 | ||
sheet | 0.231 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY338395.1 | complete | 146 | 2-442(+) |
Amino Acid sequence : | |||
MTTRFKKNRKKRGHVSAGHGRIGKHRKHPGGRGNAGGMHHHRILFDKYHPGYFGKVGMRYFHKLRNKFFCPTVNIDRLWALVPQEVKDKATKDNAPLIDVTQFGYFKVLGKGLLPADKPV VVKAKLVSKNAEKKIKEAGGAVVLTA* | |||
Physicochemical properties | |||
Number of amino acids: | 146 | ||
Molecular weight: | 13,654.226 | ||
Theoretical pI: | 11.673 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 37470 37470 | ||
Instability index: | 89.991 | ||
aromaticity | 0.077 | ||
GRAVY | -1.244 | ||
Secondary Structure Fraction | |||
Helix | 0.214 | ||
turn | 0.274 | ||
sheet | 0.231 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY338395.1 | 5prime_partial | 117 | 1-354(+) |
Amino Acid sequence : | |||
NDNQIQEEPQEARPRERRPWSYRQAPQASRWSRKRWWYAPPPHPLRQVPSWLLRQGRYALLPQAPQQVLLPNRQHRPPLGARPARGEGQGDQGQRAAHRCHAVWILQGVGEGIASRR* | |||
Physicochemical properties | |||
Number of amino acids: | 117 | ||
Molecular weight: | 13,654.226 | ||
Theoretical pI: | 11.673 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 37470 37470 | ||
Instability index: | 89.991 | ||
aromaticity | 0.077 | ||
GRAVY | -1.244 | ||
Secondary Structure Fraction | |||
Helix | 0.214 | ||
turn | 0.274 | ||
sheet | 0.231 |